Overview

  • Product name

  • Description

    Rabbit polyclonal to TRBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human TRBP aa 1-366.
    Sequence:

    MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDL LKAEGQAHQPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSM LEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLTRSPPMELQPP VSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVER FIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVG SRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGE AARRALQYLKIMAGSK


    Database link: Q15633

  • Positive control

    • IHC-P: Human endometrial cancer and placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, EIF2C2/AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto EIF2C2/AGO2. EIF2C2/AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1. Binds to the HIV-1 TAR RNA which is located in the long terminal repeat (LTR) of HIV-1, and stimulates translation of TAR-containing RNAs. This is achieved in part at least by binding to and inhibiting EIF2AK2/PKR, thereby reducing phosphorylation and inhibition of EIF2S1/eIF-2-alpha. May also promote translation of TAR-containing RNAs independently of EIF2AK2/PKR.
  • Sequence similarities

    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Cellular localization

    Cytoplasm. Cytoplasm > perinuclear region. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • LOQS antibody
    • Prbp antibody
    • RISC loading complex subunit TARBP2 antibody
    • RISC-loading complex subunit tarbp2 antibody
    • TAR (HIV 1) RNA binding protein 2 antibody
    • TAR (HIV) RNA binding protein 2 antibody
    • TAR (HIV) RNA-binding protein TRBP1 antibody
    • TAR RNA Binding Protein 2 antibody
    • TAR RNA-binding protein 2 antibody
    • tarbp2 antibody
    • TARBP2 RISC loading complex RNA binding subunit antibody
    • Trans-activation-responsive RNA-binding protein antibody
    • TRBP antibody
    • TRBP1 antibody
    • TRBP2 antibody
    • TRBP2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human endometrial cancer stained for TRBP using ab235904 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta stained for TRBP using ab235904 at 1/100 dilution in immunohistochemical analysis.

References

ab235904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up