Overview

  • Product name

    Anti-Trefoil Factor 3 antibody
    See all Trefoil Factor 3 primary antibodies
  • Description

    Rabbit polyclonal to Trefoil Factor 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Trefoil Factor 3 aa 50-80 conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    KECNNRGCCFDSRIPGVPWCFKPLQEAECTF


    Database link: Q07654

  • Positive control

    • Mouse small intestine tissue and HT-29 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody)

Target

Images

  • Immunohistochemical analysis of paraffin embedded mouse small intestine tissue labeling TFF3 with ab202967 1:200, followed by secondary antibody and DAB staining.

  • Flow cytometric analysis of HT-29 cells labeling Trefoil Factor 3 with ab202967 at 1/100 dilution for 60 minutes at room temperature (green histogram) compared to a negative control cell (blue histogram). Detection utilised Goat Anti-Rabbit IgG (H + L) Alexa Fluor 488 Conjugated Secondary Antibody.

References

ab202967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up