Overview

  • Product name

    Anti-Trefoil Factor 3 antibody
    See all Trefoil Factor 3 primary antibodies
  • Description

    Rabbit polyclonal to Trefoil Factor 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Rat Trefoil Factor 3 aa 23-81. (N-terminal His and GST Tag; expressed in E.coli).
    Sequence:

    QEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFK PLQETECTF


    Database link: Q03191

  • Positive control

    • IHC-P: Rat intestine, kidney and stomach tissues. WB: Rat uterus lysate; Recombinant rat Trefoil Factor 3 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231546 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 9 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
  • Tissue specificity

    Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus.
  • Sequence similarities

    Contains 1 P-type (trefoil) domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > apical lamina.
  • Information by UniProt
  • Database links

  • Alternative names

    • hITF antibody
    • hP1.B antibody
    • Intestinal trefoil factor antibody
    • ITF antibody
    • mITF antibody
    • OTTMUSP00000021729 antibody
    • P1B antibody
    • Polypeptide P1.B antibody
    • TFF3 antibody
    • TFF3_HUMAN antibody
    • TFI antibody
    • TREFOIL antibody
    • Trefoil factor (intestinal) antibody
    • Trefoil factor 3 antibody
    see all

Images

  • Paraffin-embedded rat intestine tissue stained for Trefoil Factor 3 using ab231546 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for Trefoil Factor 3 using ab231546 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for Trefoil Factor 3 using ab231546 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Trefoil Factor 3 antibody (ab231546) at 3 µg/ml + Recombinant rat Trefoil Factor 3 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 9 kDa

  • Anti-Trefoil Factor 3 antibody (ab231546) at 3 µg/ml + Rat uterus lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 9 kDa

References

ab231546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up