Overview

  • Product name

  • Description

    Rabbit polyclonal to TREK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Synthetic peptide corresponding to Human TREK1 aa 1-100 (N terminal).
    Sequence:

    MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVES DTTINVMKWK


    Database link: Q9NRT2

  • Positive control

    • Human brain membrane lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
  • Application notes
    WB: Use at a concentration of 2 µg/ml. Predicted molecular weight: 47 kDa.
    It is essential to run against membrane preps.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Function

      Outward rectifying potassium channel.
    • Sequence similarities

      Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
    • Cellular localization

      Membrane.
    • Information by UniProt
    • Database links

    • Alternative names

      • hTREK 1c antibody
      • hTREK 1e antibody
      • K2p2.1 antibody
      • K2P2.1 potassium channel antibody
      • KCNK 2 antibody
      • Kcnk2 antibody
      • KCNK2_HUMAN antibody
      • MGC126742 antibody
      • MGC126744 antibody
      • Outward rectifying potassium channel protein TREK 1 antibody
      • Outward rectifying potassium channel protein TREK-1 antibody
      • Outward rectifying potassium channel protein TREK1 antibody
      • Potassium channel subfamily K member 2 antibody
      • Potassium inwardly rectifying channel subfamily K member 2 antibody
      • Tandem pore domain potassium channel TREK 1 antibody
      • Tandem pore domain potassium channel TREK1 antibody
      • TPKC1 antibody
      • TREK 1 antibody
      • TREK 1 K(+) channel subunit antibody
      • TREK antibody
      • TREK-1 K(+) channel subunit antibody
      • TREK1 antibody
      • TWIK related potassium channel 1 antibody
      • Two pore domain potassium channel TREK 1 antibody
      • Two pore domain potassium channel TREK-1 antibody
      • Two pore domain potassium channel TREK1 antibody
      • Two pore potassium channel 1 antibody
      • Two pore potassium channel TPKC1 antibody
      see all

    Images

    • Anti-TREK1 antibody (ab90855) at 2 µg/ml + Human brain membrane lysate

      Predicted band size: 47 kDa

    References

    This product has been referenced in:

    • Andharia N  et al. Involvement of intracellular transport in TREK-1c current run-up in 293T cells. Channels (Austin) 11:224-235 (2017). Read more (PubMed: 28085542) »
    • Bieling F  et al. Sepsis varies arterial two-pore-domain potassium channel messenger RNA in mice. J Surg Res 193:816-24 (2015). Read more (PubMed: 25300694) »
    See all 2 Publications for this product

    Customer reviews and Q&As

    1-5 of 5 Abreviews or Q&A

    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (heart valve)
    Permeabilization
    Yes - tierton x
    Specification
    heart valve
    Blocking step
    BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: RT°C
    Fixative
    Paraformaldehyde

    Hessah Alshammari

    Verified customer

    Submitted Nov 11 2016

    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Human Tissue sections (heart valve)
    Antigen retrieval step
    Heat mediated
    Permeabilization
    No
    Specification
    heart valve
    Blocking step
    endogenous peroxidases as blocking agent for 10 minute(s) · Concentration: 0.3% · Temperature: RT°C
    Fixative
    Formaldehyde

    Hessah Alshammari

    Verified customer

    Submitted Nov 09 2016

    Application
    Immunohistochemistry (PFA perfusion fixed frozen sections)
    Sample
    Mouse Tissue sections (Brain (motor cortex))
    Antigen retrieval step
    None
    Permeabilization
    Yes - 0.1% Triton X-100
    Specification
    Brain (motor cortex)
    Blocking step
    Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 22°C
    Fixative
    Paraformaldehyde

    Patrick Ye

    Verified customer

    Submitted Aug 11 2016

    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (293 cells)
    Permeabilization
    Yes - Tx-100
    Specification
    293 cells
    Blocking step
    BSA as blocking agent for 10 minute(s) · Concentration: 0.3% · Temperature: 25°C
    Fixative
    Paraformaldehyde

    Abcam user community

    Verified customer

    Submitted Nov 04 2014

    Answer

    The antibody should still bind to the protein as its made from an immunogen containing the entire region of amino acids from 1-100.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up