Overview

  • Product name

    Anti-TREM2 antibody [MM0942-42E14]
    See all TREM2 primary antibodies
  • Description

    Mouse monoclonal [MM0942-42E14] to TREM2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TREM2 aa 19-173.
    Sequence:

    HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHN LWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEA DTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEI PFPPT


    Database link: Q9NZC2

  • Positive control

    • IHC-P: Human brain tissue. ICC/IF: Rat neuronal cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    The IgG fraction of culture supernatant was purified by Protein G affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    MM0942-42E14
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 26 kDa.
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
  • Tissue specificity

    Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.
  • Involvement in disease

    Defects in TREM2 are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL) [MIM:221770]; also known as presenile dementia with bone cysts or Nasu-Hakola disease (NHD). PLOSL is a recessively inherited disease characterized by a combination of psychotic symptoms rapidly progressing to presenile dementia and bone cysts restricted to wrists and ankles. PLOSL has a global distribution, although most of the patients have been diagnosed in Finland and Japan, with an estimated population prevalence of 2x10(-6) in the Finns.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • TREM 2 antibody
    • TREM-2 antibody
    • TREM2 antibody
    • TREM2_HUMAN antibody
    • TREM2a antibody
    • TREM2b antibody
    • TREM2c antibody
    • Trggering receptor expressed on myeloid cells 2 antibody
    • Trggering receptor expressed on myeloid cells 2a antibody
    • Triggering receptor expressed on monocytes 2 antibody
    • Triggering receptor expressed on myeloid cells 2 antibody
    see all

Images

  • Anti-TREM2 antibody [MM0942-42E14] (ab201621) at 1/500 dilution + HumanTHP-1 Cell Lysate at 100 µg

    Predicted band size: 26 kDa

  • Immunocytochemistry/Immunofluorescence analysis of rat neuronal cells labeling TREM2 with ab201621 at 1/500.

    Cells were fixed with methanol and permeabilized with 0.1M PBS with 1% Triton X. The secondary antibody used was an Alexa Fluor® 568-conjugated at 1/3000. Nucleus stained with DAPI.

    See Abreview

  • ab201621 staining TREM2 in human brain tissue sections by Immunohistochemistry (IHC-P - formaldehyde-fixed, paraffin-embedded sections).

    Tissue was fixed with formaldehyde and blocked with 10% serum for 1 hour at 24°C; antigen retrieval was by heat mediation in a citrate buffer. Samples were incubated with primary antibody (1/100 in 0.1M PBS with 3% TritonX) for 24 hours at 4°C. A undiluted Alexa Fluor® 568 donkey monoclonal was used as the secondary antibody.

    See Abreview

References

This product has been referenced in:

  • Raha-Chowdhury R  et al. Choroid Plexus Acts as Gatekeeper for TREM2, Abnormal Accumulation of ApoE, and Fibrillary Tau in Alzheimer's Disease and in Down Syndrome Dementia. J Alzheimers Dis 69:91-109 (2019). Read more (PubMed: 30909239) »
  • Raha-Chowdhury R  et al. Erythromyeloid-Derived TREM2: A Major Determinant of Alzheimer's Disease Pathology in Down Syndrome. J Alzheimers Dis 61:1143-1162 (2018). Read more (PubMed: 29278889) »
See all 2 Publications for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rat Tissue sections (brain)
Antigen retrieval step
Other
Permeabilization
Yes - triton 1%
Specification
brain
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5 · Temperature: 20°C
Fixative
Paraformaldehyde

Mrs. Francoise Geffroy

Verified customer

Submitted Dec 06 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Brain)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 0.1M Citrate buffer
Permeabilization
Yes - 0.1M PBS with 3% Triton X
Specification
Brain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 24°C
Fixative
Formaldehyde

Dr. Ruma Raha-Chowdhury

Verified customer

Submitted Mar 27 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rat Tissue sections (pancreas)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: sodium citrate, pressure cooker
Permeabilization
No
Specification
pancreas
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 22°C
Fixative
zinc

Dr. Thea Golden

Verified customer

Submitted Jan 17 2017

Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (Neuronal cell line)
Permeabilization
Yes - 0.1M PBS with 1% Triton X
Specification
Neuronal cell line
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 24°C
Fixative
Methanol

Dr. Ruma Raha-Chowdhury

Verified customer

Submitted Sep 16 2016

Application
Western blot
Sample
Human Serum (Human serum)
Gel Running Conditions
Reduced Denaturing (10% Bis-Tris gel)
Loading amount
30 µg
Specification
Human serum
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Dr. Ruma Raha-Chowdhury

Verified customer

Submitted Nov 06 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up