Overview

  • Product name

    Anti-TRF1 [572C] antibody
    See all TRF1 primary antibodies
  • Description

    Rat monoclonal [572C] to TRF1
  • Host species

    Rat
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Mouse TRF1 aa 1-421.
    Sequence:

    MAETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMEN AELVAEVEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLH RLTAYQLKTVYICQFLTRVASGKALDAQFEVDERITPLESALMIWNSIEK EHDKLHDEIKNLIKIQAVAVCMEIGSFKEAEEVFERIFGDPEFYTPLERK LKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSSTFLMKAATKVV ENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSS IRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCV SENQPDTDDKSGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNN RTSVMLKDRWRTMKRLKLI


    Database link: P70371

  • Positive control

    • IHC: HEK-TRF1 and HEK-TRF2 transfected cell lines. WB: NIH-3T3 and Hek-TRF1 cell lysate, IPS-GFP-TRF1 homo cell lysate. ICC/IF: iPS cells,HRK-TRF1 and IPS-GFP-TRF1homo cell lines.

Properties

Applications

Our Abpromise guarantee covers the use of ab192629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 50 kDa.

Target

  • Function

    Binds the telomeric double-stranded TTAGGG repeat and negatively regulates telomere length. Involved in the regulation of the mitotic spindle. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.
  • Tissue specificity

    Highly expressed and ubiquitous. Isoform Pin2 predominates.
  • Sequence similarities

    Contains 1 HTH myb-type DNA-binding domain.
  • Domain

    The acidic N-terminal domain binds to the ankyrin repeats of TNKS1 and TNKS2. The C-terminal domain binds microtubules.
    The TRFH dimerization region mediates the interaction with TINF2.
  • Post-translational
    modifications

    Phosphorylated preferentially on Ser-219 in an ATM-dependent manner in response to ionizing DNA damage.
    ADP-ribosylation by TNKS1 or TNKS2 diminishes its ability to bind to telomeric DNA.
    Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome. Ubiquitinated by a SCF (SKP1-CUL1-F-box protein) ubiquitin-protein ligase complex, leading to its degradation by the proteasome.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle. Chromosome > telomere. Colocalizes with telomeric DNA in interphase and metaphase cells and is located at chromosome ends during metaphase. Associates with the mitotic spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • hTRF1 AS antibody
    • NIMA interacting protein 2 antibody
    • NIMA-interacting protein 2 antibody
    • PIN 2 antibody
    • PIN2 antibody
    • t TRF1 antibody
    • Telomeric protein Pin2 antibody
    • Telomeric protein Pin2/TRF1 antibody
    • Telomeric repeat binding factor (NIMA interacting) 1 antibody
    • Telomeric repeat binding factor 1 antibody
    • Telomeric repeat binding protein 1 antibody
    • Telomeric repeat-binding factor 1 antibody
    • TERF 1 antibody
    • Terf1 antibody
    • TERF1_HUMAN antibody
    • TRBF 1 antibody
    • TRBF1 antibody
    • TRF 1 antibody
    • TRF antibody
    • TTAGGG repeat binding factor 1 antibody
    • TTAGGG repeat-binding factor 1 antibody
    see all

Images

  • All lanes : Anti-TRF1 [572C] antibody (ab192629)

    Lane 1 : IPS-GFP-TRF1 homo at 100 µg
    Lane 2 : IPS-GFP-TRF1 heter at 100 µg
    Lane 3 : IPS-sh TRF1 at 100 µg
    Lane 4 : IPS-sh TRF1 puro at 100 µg
    Lane 5 : HEK-TRF1 at 20 µg
    Lane 6 : HEK-FGFR2 at 20 µg
    Lane 7 : NIH-3T3 at 100 µg

    Predicted band size: 50 kDa



    ab192629 used undiluted for all lanes.

  • Immunocytochemistry/ Immunofluorescent analysis of HEK-TRF1, HEK-GFP-TRF2, IPS-GFP-TRF1homo and IPS-shTRF1homo cell lines labeling TRF1 with undiluted ab192629.

  • Immunocytochemistry/ Immunofluorescent analysis of frozen cytospins preparations of mTRF1 expressed in HEK293T labeling TRF1 using ab192629. Negative control on right used mTRF2-GFP expressed in HEK293T.

  • All lanes : Anti-TRF1 [572C] antibody (ab192629) at 1/500 dilution

    Lane 1 : Mefs TRF1 +/+ nuclear extract
    Lane 2 : Mefs TRF1 KO nuclear extract

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 50 kDa

  • Immunocytochemistry/ Immunofluorescent analysis of mouse blastocyte labeling TRF1 with ab192629 at a 1/100 dilution.

References

ab192629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up