Overview

  • Product name

  • Description

    Rabbit polyclonal to TRF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human TRF1 aa 260-439.
    Sequence:

    AAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSE GTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATE SRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLH YKFNNRTSVMLKDRWRTMKKLKLISSDSED


    Database link: P54274

  • Positive control

    • IHC-P: Human skeletal muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds the telomeric double-stranded TTAGGG repeat and negatively regulates telomere length. Involved in the regulation of the mitotic spindle. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.
  • Tissue specificity

    Highly expressed and ubiquitous. Isoform Pin2 predominates.
  • Sequence similarities

    Contains 1 HTH myb-type DNA-binding domain.
  • Domain

    The acidic N-terminal domain binds to the ankyrin repeats of TNKS1 and TNKS2. The C-terminal domain binds microtubules.
    The TRFH dimerization region mediates the interaction with TINF2.
  • Post-translational
    modifications

    Phosphorylated preferentially on Ser-219 in an ATM-dependent manner in response to ionizing DNA damage.
    ADP-ribosylation by TNKS1 or TNKS2 diminishes its ability to bind to telomeric DNA.
    Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome. Ubiquitinated by a SCF (SKP1-CUL1-F-box protein) ubiquitin-protein ligase complex, leading to its degradation by the proteasome.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle. Chromosome > telomere. Colocalizes with telomeric DNA in interphase and metaphase cells and is located at chromosome ends during metaphase. Associates with the mitotic spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • hTRF1 AS antibody
    • NIMA interacting protein 2 antibody
    • NIMA-interacting protein 2 antibody
    • PIN 2 antibody
    • PIN2 antibody
    • t TRF1 antibody
    • Telomeric protein Pin2 antibody
    • Telomeric protein Pin2/TRF1 antibody
    • Telomeric repeat binding factor (NIMA interacting) 1 antibody
    • Telomeric repeat binding factor 1 antibody
    • Telomeric repeat binding protein 1 antibody
    • Telomeric repeat-binding factor 1 antibody
    • TERF 1 antibody
    • Terf1 antibody
    • TERF1_HUMAN antibody
    • TRBF 1 antibody
    • TRBF1 antibody
    • TRF 1 antibody
    • TRF antibody
    • TTAGGG repeat binding factor 1 antibody
    • TTAGGG repeat-binding factor 1 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for TRF1 using ab235948 at 1/100 dilution in immunohistochemical analysis.

References

ab235948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up