Overview

  • Product name

  • Description

    Rabbit polyclonal to TRFP/MED20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human TRFP/MED20 aa 83-132 (internal sequence).
    Sequence:

    PCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMG


    Database link: NP_004266.2

  • Positive control

    • RPMI-8226 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab135362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Relevance

    TRFP / MED20 is a member of the mediator complex that can act as both a positive and negative regulator of transcription. The mediator complex interacts with RNA pol II and its associated proteins, the general transcription factors. Mediator proteins serve as a bridge connecting the activator and basal transcription machinery.
  • Cellular localization

    Nucleus
  • Database links

  • Alternative names

    • MED20 antibody
    • Mediator complex subunit 20 antibody
    • TRF proximal protein homolog antibody
    • TRFP antibody

Images

  • Anti-TRFP/MED20 antibody (ab135362) at 1 µg/ml + RPMI-8226 cell lysate at 10 µg

    Predicted band size: 23 kDa

References

ab135362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up