Overview

  • Product name

  • Description

    Rabbit polyclonal to Triadin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Triadin aa 486-687. (Expressed in E. coli.)
    Sequence:

    LKKEEKSEPQVKKEAKLASSEKGQTRKQNITRPEQVIPHGKPEQKVPKQI KAITAEKTEKAERQEKYHPSIKTEGKPEVTDSGKKKIEKPEKESKVPPKQ ENLQVRNVTRAEKRGKISKDSKDAPAPKKDKDSKDVLHSKKDKEVTNNVS SPKKQKSPISFFQCVYLDGYNGYGFQFPVTPVQHSGENPGKSNSPGQKQQ EQ


    Database link: Q9QX75-1

  • Positive control

    • IHC-P: Skeletal muscle tissue. WB: Recombinant rat Triadin protein; Mouse skeletal muscle and heart lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May be involved in anchoring calsequestrin to the junctional sarcoplasmic reticulum and allowing its functional coupling with the ryanodine receptor.
  • Involvement in disease

    TRDN mutations have been found in catecholaminergic polymorphic ventricular tachycardia (CPVT) (PubMed:22422768). CPVT is an arrhythmogenic disorder characterized by stress-induced, bidirectional ventricular tachycardia that may degenerate into cardiac arrest and cause sudden death.
  • Post-translational
    modifications

    Phosphorylated by CaMK2.
  • Cellular localization

    Cell membrane. Sarcoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ166D18.1 antibody
    • DKFZp779I2253 antibody
    • MGC88285 antibody
    • OTTHUMP00000040354 antibody
    • TDN antibody
    • TRDN antibody
    • TRDN_HUMAN antibody
    • Triadin antibody
    • TRISK 51 antibody
    • TRISK antibody
    • TRISK51 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat skeletal muscle tissue stained for Triadin with ab231058 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Triadin antibody (ab231058) at 2 µg/ml + mouse heart lysate

    Developed using the ECL technique.
  • Anti-Triadin antibody (ab231058) at 2 µg/ml + mouse skeletal muscle lysate

    Developed using the ECL technique.
  • Anti-Triadin antibody (ab231058) at 2 µg/ml + recombinant rat Triadin protein

    Developed using the ECL technique.

References

ab231058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up