Overview

  • Product name

    Anti-TRIAP1 antibody
  • Description

    Rabbit polyclonal to TRIAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human TRIAP1 aa 1-76.
    Sequence:

    MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQK AIKEKEIPIEGLEFMGHGKEKPENSS


    Database link: O43715

  • Positive control

    • IHC-P: Human small intestine and adrenal gland tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab225938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human adrenal gland tissue stained for TRIAP1 using ab225938 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for TRIAP1 using ab225938 at 1/100 dilution in immunohistochemical analysis.

References

ab225938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up