Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human TRIB2 aa 170-220 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    GLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYV S


    Database link: Q92519

  • Positive control

    • Human lung cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab204119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 39 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

Target

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human lung cancer tissue labeling TRIB2 with ab204119 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human lung cancer tissue labeling TRIB2 with ab204119 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

References

ab204119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up