Overview

  • Product name

    Anti-TRIB2 antibody [OTI8D11]
    See all TRIB2 primary antibodies
  • Description

    Mouse monoclonal [OTI8D11] to TRIB2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, African green monkey
    Predicted to work with: Mouse, Cow, Dog, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human TRIB2 aa 1-343. Produced in HEK-293T cells (NP_067675).
    Sequence:

    MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPE TPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQES LAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREE EAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAY ILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVG RYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ EILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN


    Database link: Q92519

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY TRIB2 cDNA; MCF7 cell extract. IHC-P: Human breast adenocarcinoma, colon adenocarcinoma, kidney carcinoma, ovary adenocarcinoma, thyroid carcinoma, endometrium and bladder carcinoma tissues. ICC/IF: COS7 cells. FLow Cyt: HEK-293T cells transfected with TRIB2 overexpress plasmid.
  • General notes

    Clone OTI8D11 (formerly 8D11).

Properties

Applications

Our Abpromise guarantee covers the use of ab117981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 39 kDa.
IHC-P 1/50.
Flow Cyt 1/100.
ICC/IF 1/50.

Target

Images

  • All lanes : Anti-TRIB2 antibody [OTI8D11] (ab117981) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY TRIB2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 39 kDa

  • All lanes : Anti-TRIB2 antibody [OTI8D11] (ab117981) at 1/1000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : HT-29 (human colorectal adenocarcinoma cell line) cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 39 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC201210)
  • Paraffin-embedded human breast adenocarcinoma tissue stained for TRIB2 using ab117981 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon adenocarcinoma tissue stained for TRIB2 using ab117981 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney carcinoma tissue stained for TRIB2 using ab117981 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for TRIB2 using ab117981 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thryoid carcinoma tissue stained for TRIB2 using ab117981 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for TRIB2 using ab117981 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for TRIB2 using ab117981 at 1/50 dilution in immunohistochemical analysis.

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells stained for TRIB2 (green) using ab117981 at 1/50 dilution in ICC/IF.

  • Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either TRIB2 overexpress plasmid (Red) or empty vector control plasmid (Blue) labeling TRIB2 with ab117981 at 1/50 dilution.

References

This product has been referenced in:

  • Xu S  et al. TRIB2 inhibits Wnt/ß-Catenin/TCF4 signaling through its associated ubiquitin E3 ligases, ß-TrCP, COP1 and Smurf1, in liver cancer cells. FEBS Lett 588:4334-41 (2014). Read more (PubMed: 25311538) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up