Anti-TRIF antibody [OTI1G7] (ab139281)
Key features and details
- Mouse monoclonal [OTI1G7] to TRIF
- Suitable for: WB
- Reacts with: Mouse, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-TRIF antibody [OTI1G7]
See all TRIF primary antibodies -
Description
Mouse monoclonal [OTI1G7] to TRIF -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Dog, Human, African green monkey -
Immunogen
Recombinant fragment corresponding to Human TRIF aa 120-420. Produced in E.coli (NP_891549).
Sequence:EAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSS ALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLS LHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPS SPPPGLPEVAPDATSTGLPDTPAAPETSTNYPVECTEGSAGPQSLPLPIL EPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSPPPPPPPPSS TPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEAL G
Database link: Q8IUC6 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY TRIF cDNA; HepG2, HeLa and COS-7 cell extracts.
-
General notes
The clone number has been updated from 1G7 to OTI1G7, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1G7 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab139281 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000. Predicted molecular weight: 76 kDa.
|
Notes |
---|
WB
1/2000. Predicted molecular weight: 76 kDa. |
Target
-
Function
Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively. -
Tissue specificity
Ubiquitously expressed but with higher levels in liver. -
Sequence similarities
Contains 1 TIR domain. -
Domain
The N-terminal region is essential for activation of the IFNB promoter activity. -
Post-translational
modificationsPhosphorylated by TBK1. - Information by UniProt
-
Database links
- Entrez Gene: 611852 Dog
- Entrez Gene: 148022 Human
- Entrez Gene: 106759 Mouse
- Omim: 607601 Human
- SwissProt: Q8IUC6 Human
- SwissProt: Q80UF7 Mouse
- Unigene: 29344 Human
- Unigene: 203952 Mouse
-
Alternative names
- IIAE6 antibody
- MGC35334 antibody
- MyD88 3 antibody
see all
Images
-
All lanes : Anti-TRIF antibody [OTI1G7] (ab139281) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY TRIF cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 76 kDa -
All lanes : Anti-TRIF antibody [OTI1G7] (ab139281) at 1/2000 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (canine kidney cell line) cell extract
Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 76 kDa
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab139281 has not yet been referenced specifically in any publications.