Anti-TRIF antibody [OTI1G7] (ab139281)

Submit a review Q&A (1)

Overview

  • Product name

    Anti-TRIF antibody [OTI1G7]
    See all TRIF primary antibodies

  • Description

    Mouse monoclonal [OTI1G7] to TRIF

  • Host species

    Mouse

  • Tested applications

    Suitable for: WBmore details

  • Species reactivity

    Reacts with: Human, Monkey

  • Immunogen

    Recombinant fragment corresponding to Human TRIF aa 120-420. Produced in E.coli (NP_891549).
    Sequence:

    EAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSS ALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLS LHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPS SPPPGLPEVAPDATSTGLPDTPAAPETSTNYPVECTEGSAGPQSLPLPIL EPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSPPPPPPPPSS TPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEAL G


    Database link: Q8IUC6

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY TRIF cDNA; HepG2, HeLa and COS-7 cell extracts.

  • General notes

    The clone number has been updated from 1G7 to OTI1G7, both clone numbers name the same clone.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...

  • Purity

    Affinity purified

  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.

  • Clonality

    Monoclonal

  • Clone number

    OTI1G7

  • Isotype

    IgG1

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab139281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 76 kDa.

Target

  • Function

    Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively.

  • Tissue specificity

    Ubiquitously expressed but with higher levels in liver.

  • Sequence similarities

    Contains 1 TIR domain.

  • Domain

    The N-terminal region is essential for activation of the IFNB promoter activity.

  • Post-translational
    modifications

    Phosphorylated by TBK1.
  • Information by UniProt

  • Database links

    • Alternative names

      • IIAE6 antibody
      • MGC35334 antibody
      • MyD88 3 antibody
      • Proline rich vinculin and TIR domain containing protein B antibody
      • Proline-rich antibody
      • PRVTIRB antibody
      • Putative NF kappa B activating protein 502H antibody
      • Putative NF-kappa-B-activating protein 502H antibody
      • Putative NFkB activating protein antibody
      • TCAM1_HUMAN antibody
      • TICAM 1 antibody
      • TICAM-1 antibody
      • Ticam1 antibody
      • TIR domain containing adapter molecule 1 antibody
      • TIR domain containing adapter protein inducing IFN beta antibody
      • TIR domain containing adaptor inducing interferon beta antibody
      • TIR domain-containing adapter molecule 1 antibody
      • TIR domain-containing adapter protein inducing IFN-beta antibody
      • Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta antibody
      • Toll like receptor adaptor molecule 1 antibody
      • Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta antibody
      • TRIF antibody
      • TRIF protein antibody
      • vinculin and TIR domain-containing protein B antibody
      see all

    Images

    • Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      All lanes : Anti-TRIF antibody [OTI1G7] (ab139281) at 1/2000 dilution

      Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
      Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY TRIF cDNA

      Lysates/proteins at 5 µg per lane.

      Predicted band size: 76 kDa

    • Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      All lanes : Anti-TRIF antibody [OTI1G7] (ab139281) at 1/2000 dilution

      Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
      Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
      Lane 3 : SVT2 cell extract
      Lane 4 : A549 (human lung carcinoma cell line) cell extract
      Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
      Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
      Lane 7 : MDCK (canine kidney cell line) cell extract
      Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
      Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

      Lysates/proteins at 35 µg per lane.

      Predicted band size: 76 kDa

    References

    ab139281 has not yet been referenced specifically in any publications.

    Publishing research using ab139281? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    I was interested in the TRIF monoclonal antibody you have list ab139281, I plan to do western blot analysis for TRIF on ovarian cancer cell lysates, I was wondering have you ever tested it in ovarian samples before? Also there seems to be a band appearing in all the pictures at around 55kDa aswell as the 76kDa for TRIF which has me a little concerned, does your technical team know whether this is just non specific staining or a splice variant or something?

    Read More
    Answer


    We have not specifically tested this antibody on ovarian cancer cell lysates however according to the human protein atlas and uniprot, this protein is ubiquitously expressed and therefore should be present and show a band in ovarian samples. I would also recommend performing a positive control using liver lysates which have a higher expression of this protein.
    With regards to the band at 55 kDa, unfortunately we have not determined to what this band corresponds to. Looking at other antibodies against this target in our catalogue and from other suppliers, these also seem to give a band at this molecular weight.
    The following paper suggests that this is a fragment of TRIF however this has not been confirmed and so we cannot guarantee this: http://www.plospathogens.org/article/info%3Adoi%2F10.1371%2Fjournal.ppat.1002169

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up