For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    trif-antibody-oti1g7-ab139281.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines Interferons
Share by email

Anti-TRIF antibody [OTI1G7] (ab139281)

  • Datasheet
  • SDS
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
  • Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)

Key features and details

  • Mouse monoclonal [OTI1G7] to TRIF
  • Suitable for: WB
  • Reacts with: Mouse, Dog, Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Protein
Product image
Recombinant Human TRIF protein (ab153605)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-TRIF antibody [OTI1G7]
    See all TRIF primary antibodies
  • Description

    Mouse monoclonal [OTI1G7] to TRIF
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Dog, Human, African green monkey
  • Immunogen

    Recombinant fragment corresponding to Human TRIF aa 120-420. Produced in E.coli (NP_891549).
    Sequence:

    EAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSS ALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLS LHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPS SPPPGLPEVAPDATSTGLPDTPAAPETSTNYPVECTEGSAGPQSLPLPIL EPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSPPPPPPPPSS TPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEAL G


    Database link: Q8IUC6
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY TRIF cDNA; HepG2, HeLa and COS-7 cell extracts.
  • General notes

    The clone number has been updated from 1G7 to OTI1G7, both clone numbers name the same clone.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1G7
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Innate Immunity
    • Cytokines
    • Interferons
    • Immunology
    • Innate Immunity
    • TLR Signaling

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • Hep G2 whole cell lysate (ab166833)
    • HeLa whole cell lysate (ab29545)
  • Recombinant Protein

    • Recombinant Human TRIF protein (ab153605)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab139281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
1/2000. Predicted molecular weight: 76 kDa.
Notes
WB
1/2000. Predicted molecular weight: 76 kDa.

Target

  • Function

    Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively.
  • Tissue specificity

    Ubiquitously expressed but with higher levels in liver.
  • Sequence similarities

    Contains 1 TIR domain.
  • Domain

    The N-terminal region is essential for activation of the IFNB promoter activity.
  • Post-translational
    modifications

    Phosphorylated by TBK1.
  • Target information above from: UniProt accession Q8IUC6 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 611852 Dog
    • Entrez Gene: 148022 Human
    • Entrez Gene: 106759 Mouse
    • Omim: 607601 Human
    • SwissProt: Q8IUC6 Human
    • SwissProt: Q80UF7 Mouse
    • Unigene: 29344 Human
    • Unigene: 203952 Mouse
    • Alternative names

      • IIAE6 antibody
      • MGC35334 antibody
      • MyD88 3 antibody
      • Proline rich vinculin and TIR domain containing protein B antibody
      • Proline-rich antibody
      • PRVTIRB antibody
      • Putative NF kappa B activating protein 502H antibody
      • Putative NF-kappa-B-activating protein 502H antibody
      • Putative NFkB activating protein antibody
      • TCAM1_HUMAN antibody
      • TICAM 1 antibody
      • TICAM-1 antibody
      • Ticam1 antibody
      • TIR domain containing adapter molecule 1 antibody
      • TIR domain containing adapter protein inducing IFN beta antibody
      • TIR domain containing adaptor inducing interferon beta antibody
      • TIR domain-containing adapter molecule 1 antibody
      • TIR domain-containing adapter protein inducing IFN-beta antibody
      • Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta antibody
      • Toll like receptor adaptor molecule 1 antibody
      • Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta antibody
      • TRIF antibody
      • TRIF protein antibody
      • vinculin and TIR domain-containing protein B antibody
      see all

    Images

    • Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      All lanes : Anti-TRIF antibody [OTI1G7] (ab139281) at 1/2000 dilution

      Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
      Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY TRIF cDNA

      Lysates/proteins at 5 µg per lane.

      Predicted band size: 76 kDa

    • Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      Western blot - Anti-TRIF antibody [OTI1G7] (ab139281)
      All lanes : Anti-TRIF antibody [OTI1G7] (ab139281) at 1/2000 dilution

      Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
      Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
      Lane 3 : SVT2 cell extract
      Lane 4 : A549 (human lung carcinoma cell line) cell extract
      Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
      Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
      Lane 7 : MDCK (canine kidney cell line) cell extract
      Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
      Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

      Lysates/proteins at 35 µg per lane.

      Predicted band size: 76 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab139281? Please let us know so that we can cite the reference in this datasheet.

    ab139281 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    I was interested in the TRIF monoclonal antibody you have list ab139281, I plan to do western blot analysis for TRIF on ovarian cancer cell lysates, I was wondering have you ever tested it in ovarian samples before? Also there seems to be a band appearing in all the pictures at around 55kDa aswell as the 76kDa for TRIF which has me a little concerned, does your technical team know whether this is just non specific staining or a splice variant or something?

    Read More

    Abcam community

    Verified customer

    Asked on Apr 03 2014

    Answer


    We have not specifically tested this antibody on ovarian cancer cell lysates however according to the human protein atlas and uniprot, this protein is ubiquitously expressed and therefore should be present and show a band in ovarian samples. I would also recommend performing a positive control using liver lysates which have a higher expression of this protein.
    With regards to the band at 55 kDa, unfortunately we have not determined to what this band corresponds to. Looking at other antibodies against this target in our catalogue and from other suppliers, these also seem to give a band at this molecular weight.
    The following paper suggests that this is a fragment of TRIF however this has not been confirmed and so we cannot guarantee this: http://www.plospathogens.org/article/info%3Adoi%2F10.1371%2Fjournal.ppat.1002169

    Read More

    Elisa Thomas

    Abcam Scientific Support

    Answered on Apr 03 2014

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.