Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRIM aa 29-186.
    Sequence:

    NISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENC YEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQN THFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLI RAKREPIN


    Database link: Q6PIZ9

  • Positive control

    • IHC-P: Human tonsil and thymus tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.
  • Tissue specificity

    Strongly expressed in thymus, and to a lesser extent in spleen, lymph node and peripheral blood lymphocytes. Present in T-cells and NK cells, but not B-cells (at protein level).
  • Developmental stage

    Strongly expressed in fetal thymus at weeks 17-24 of gestation. Undetectable in bone marrow and fetal liver.
  • Post-translational
    modifications

    Phosphorylated on tyrosines by LCK or FYN upon TCR activation.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • HSPC062 antibody
    • pp29/30 antibody
    • T cell receptor interacting molecule antibody
    • T-cell receptor-associated transmembrane adapter 1 antibody
    • T-cell receptor-interacting molecule antibody
    • TCRIM antibody
    • TRAT1 antibody
    • TRAT1_HUMAN antibody
    • TRIM antibody
    see all

Images

  • Paraffin-embedded human thymus tissue stained for TRIM using ab238692 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for TRIM using ab238692 at 1/100 dilution in immunohistochemical analysis.

References

ab238692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up