Overview

  • Product name

    Anti-TRIM13 antibody - N-terminal
    See all TRIM13 primary antibodies
  • Description

    Mouse polyclonal to TRIM13 - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human TRIM13 aa 1-100 (N terminal). NP_005789.2.
    Sequence:

    MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPA PFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ


    Database link: O60858

  • Positive control

    • HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab194477 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 47 kDa.

Target

  • Function

    E3 ubiquitin ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. Enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. Regulates ER stress-induced autophagy, and may act as a tumor suppressor.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Domain

    The coiled-coil domain is required for the induction of autophagy during endoplasmic reticulum (ER) stress.
    The RING-type zinc finger is required for auto-polyubiquitination.
    The C-terminal domain transmembrane domain is indispensable for the localization to the ER.
  • Post-translational
    modifications

    Auto-ubiquitinated; requires the RING-type zinc finger. Auto-polyubiquitination leads to proteasomal degradation.
  • Cellular localization

    Endoplasmic reticulum membrane. Concentrates and colocalizes with p62/SQSTM1 and ZFYVE1 at the perinuclear endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell chronic lymphocytic leukemia tumor suppressor Leu5 antibody
    • B-cell chronic lymphocytic leukemia tumor suppressor Leu5 antibody
    • CAR antibody
    • DLEU5 antibody
    • E3 ubiquitin-protein ligase TRIM13 antibody
    • HGNC:9976 antibody
    • LEU5 antibody
    • Leukemia associated protein 5 antibody
    • Leukemia-associated protein 5 antibody
    • Putative tumor suppressor RFP2 antibody
    • Ret finger protein 2 antibody
    • RFP2 antibody
    • RING finger protein 77 antibody
    • RNF77 antibody
    • TRI13_HUMAN antibody
    • Trim13 antibody
    • Tripartite motif protein 13 antibody
    • Tripartite motif-containing protein 13 antibody
    see all

Images

  • Anti-TRIM13 antibody - N-terminal (ab194477) at 1/500 dilution + HeLa cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 47 kDa

  • Anti-TRIM13 antibody - N-terminal (ab194477) at 1/1000 dilution + recombinant immunogen at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 47 kDa



    Predicted MWt of immunogen: 37.11 KDa.

References

ab194477 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194477.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up