Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIM22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRIM22 aa 134-280.
    Sequence:

    NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKI LKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTL ISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV


    Database link: Q8IYM9

  • Positive control

    • IHC-P: Human bone marrow. WB: RT4 cell lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 57 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    Trim22 is an interferon inducible protein that is preferentially expressed in cells of the haematopoietic system. Trim22 has been shown to be a p53 target gene. It also has an activation stage specific role connected to the paracrine crosstalk during T lymphocyte activation. It is strongly expressed in peripheral blood leukocytes, spleen, thymus, and ovary; expressed at basal levels in other tissues. There are two named isoforms.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus speckle. Nucleus; Cajal body. Note: Localizes predominanltly into the nucleus, found in cytoplasm to some extent. Forms distinct nuclear bodies that undergo dynamic changes during cell cycle progression. Nuclear bodies start to form in the early G0/G1 phase but become speckle-like in the S-phase and completely dispersed in mitosis. 35% of TRIM22 nuclear bodies overlap or are found adjacent to Cajal bodies.
  • Database links

  • Alternative names

    • 50 kDa stimulated trans acting factor antibody
    • GPSTAF50 antibody
    • RING finger protein 94 antibody
    • RNF94 antibody
    • Staf 50 antibody
    • STAF50 antibody
    • Stimulated trans acting factor (50 kDa) antibody
    • Stimulated Trans Acting Factor (homolog of Mouse Rpt 1 gene) antibody
    • Trim22 antibody
    • Tripartite binding motif 22 antibody
    • Tripartite motif containing protein 22 antibody
    • TTRIM22RIM22 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Trim22 (green) using ab224059 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human bone marrow stained for Trim22 with ab224059 (1/500 dilution) in immunohistochemical analysis.

References

ab224059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up