Overview

  • Product name

  • Description

    Mouse polyclonal to TRIM32
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human TRIM32 aa 1-653.
    Sequence:

    MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK LLASSINGVRCPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMC RSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFG EKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELA RSRKFFTGSLAEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQAD VALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT VNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTR KGFLKEIRRSPSGIDSFVLSFLGADLPNLTPLSVAMNCQGLIGVTDSYDN SLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDR GSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGF SIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL HFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRY STP


    Database link: AAH03154.1

  • Positive control

    • TRIM32 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 72 kDa.

Target

  • Function

    Has an E3 ubiquitin ligase activity. Ubiquitinates DTNBP1 (dysbindin) and promotes its degradation. May play a significant role in mediating the biological activity of the HIV-1 Tat protein in vivo. Binds specifically to the activation domain of HIV-1 Tat and can also interact with the HIV-2 and EIAV Tat proteins in vivo.
  • Tissue specificity

    Spleen, thymus, prostate, testis, ovary, intestine, colon and skeletal muscle.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Limb-girdle muscular dystrophy 2H (LGMD2H) [MIM:254110]: An autosomal recessive degenerative myopathy characterized by pelvic girdle, shoulder girdle and quadriceps muscle weakness. Clinical phenotype and severity are highly variable. Disease progression is slow and most patients remain ambulatory into the sixth decade of life. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Bardet-Biedl syndrome 11 (BBS11) [MIM:209900]: A syndrome characterized by usually severe pigmentary retinopathy, early-onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. Secondary features include diabetes mellitus, hypertension and congenital heart disease. Bardet-Biedl syndrome inheritance is autosomal recessive, but three mutated alleles (two at one locus, and a third at a second locus) may be required for clinical manifestation of some forms of the disease. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 5 NHL repeats.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Ubiquitinated.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic bodies, often located around the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 72 kda Tat interacting Protein antibody
    • 72 kDa Tat-interacting protein antibody
    • BBS11 antibody
    • E3 ubiquitin-protein ligase TRIM32 antibody
    • HT2A antibody
    • LGMD2H antibody
    • Limb girdle muscular dystrophy 2H (autosomal recessive) antibody
    • Limb girdle muscular dystrophy 2H antibody
    • Muscular dystrophy Hutterite type antibody
    • TAT interactive protein 72KD antibody
    • TATIP antibody
    • TRI32_HUMAN antibody
    • Trim32 antibody
    • Tripartite Motif Containing Protein 32 antibody
    • Tripartite motif-containing protein 32 antibody
    • Zinc finger protein HT2A antibody
    see all

Images

  • All lanes : Anti-TRIM32 antibody (ab172411) at 1 µg/ml

    Lane 1 : TRIM32 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 72 kDa

References

ab172411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up