Overview

  • Product name
  • Description
    Rabbit polyclonal to TRIM35
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Mouse TRIM35 aa 311-360 (internal sequence). The exact sequence is proprietary.
    Sequence:

    AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV


    Database link: Q8C006

  • Positive control
    • Mouse kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab186442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Function
    May play a role as a tumor suppressor. Implicated in the cell death mechanism.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain
    The RING finger domain and the coiled-coil region are required for the apoptosis-inducing activity.
  • Cellular localization
    Cytoplasm. Nucleus. Found predominantly in cytoplasm with a granular distribution. Found in punctuate nuclear bodies.
  • Information by UniProt
  • Database links
  • Alternative names
    • 0710005M05Rik antibody
    • A430106H13Rik antibody
    • AW046487 antibody
    • Hemopoietic lineage switch protein 5 antibody
    • HLS5 antibody
    • KIAA1098 antibody
    • Macrophage derived apoptosis inducing RBCC protein antibody
    • MAIR antibody
    • MGC17233 antibody
    • mKIAA1098 antibody
    • NC8 antibody
    • Protein MAIR antibody
    • Protein Nc8 antibody
    • TRI35_HUMAN antibody
    • TRIM35 antibody
    • Tripartite motif containing 35 antibody
    • Tripartite motif containing protein 35 antibody
    • Tripartite motif-containing protein 35 antibody
    see all

Images

  • Anti-TRIM35 antibody (ab186442) at 1 µg/ml + Mouse kidney lysate at 10 µg

    Predicted band size: 57 kDa

References

ab186442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up