Overview

  • Product name

    Anti-TRIM4 antibody - N-terminal
    See all TRIM4 primary antibodies
  • Description

    Rabbit polyclonal to TRIM4 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TRIM4 aa 1-118 (N terminal).
    Sequence:

    MEAEDIQEELTCPICLDYFQDPVSIECGHNFCRGCLHRNWAPGGGPFPCP ECRHPSAPAALRPNWALARLTEKTQRRRLGPVPPGLCGRHWEPLRLFCED DQRPVCLVCRESQEHQTH


    Database link: Q9C037

  • Positive control

    • WB: MCF7, HeLa and A459 whole cell lysates; Rat brain and heart tissue lysates. IHC-P: Human colon cancer tissue. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as RNF87. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 54,62,34,90 kDa (predicted molecular weight: 57,54,34 kDa).
ICC/IF 1/50 - 1/200.

Target

  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Information by UniProt
  • Database links

  • Alternative names

    • RING finger protein 87 antibody
    • RNF 87 antibody
    • RNF87 antibody
    • TRIM4 antibody
    • TRIM4_HUMAN antibody
    • Tripartite motif containing 4 antibody
    • Tripartite motif protein 4 antibody
    • Tripartite motif protein TRIM4 antibody
    • Tripartite motif-containing protein 4 antibody
    see all

Images

  • Lanes 1-4 : Anti-TRIM4 antibody - N-terminal (ab229952) at 1/500 dilution
    Lane 5 : Anti-TRIM4 antibody - N-terminal (ab229952) at 500 µg/ml

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : Rat brain tissue lysate
    Lane 5 : Rat heart tissue lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 57,54,34 kDa
    Observed band size: 35,55,62,90 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human colon cancer tissue stained for TRIM4 using ab229952 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for TRIM4 (green) using ab229952 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG(H+L) as secondary antibody.

References

ab229952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up