Overview

  • Product name

    Anti-TRIM43 antibody
  • Description

    Rabbit polyclonal to TRIM43
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human TRIM43 aa 362-411 (C terminal).
    Sequence:

    NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES

  • Positive control

    • 721_B cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab80460 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 52 kDa (predicted molecular weight: 52 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Relevance

    TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.
  • Database links

  • Alternative names

    • EG666731 antibody
    • Tripartite motif containing 43 antibody
    • Tripartite motif containing protein 43 antibody

Images

  • Anti-TRIM43 antibody (ab80460) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 52 kDa
    Observed band size: 52 kDa

References

This product has been referenced in:

  • Full F  et al. Centrosomal protein TRIM43 restricts herpesvirus infection by regulating nuclear lamina integrity. Nat Microbiol 4:164-176 (2019). Read more (PubMed: 30420784) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80460.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up