Overview

  • Product name

    Anti-TRIM44 antibody [OTI1E10]
    See all TRIM44 primary antibodies
  • Description

    Mouse monoclonal [OTI1E10] to TRIM44
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human TRIM44 aa 1-344. (NP_060053) produced in HEK-293T cells.
    Sequence:

    MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQ KFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESE SEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGE SEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVL CPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKV TRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT


    Database link: Q96DX7

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY TRIM44, whole cell lysate. IHC-P: Human breast, kidney, liver, liver carcinoma, pancreas, endometrium, bladder carcinoma, lymphoma and tonsil tissue. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY TRIM44.
  • General notes

    Clone OTI1E10 (formerly 1E10).

Properties

Applications

Our Abpromise guarantee covers the use of ab236422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 38 kDa.
IHC-P 1/150.

Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

ICC/IF 1/100.

Target

Images

  • All lanes : Anti-TRIM44 antibody [OTI1E10] (ab236422) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY TRIM44 cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 38 kDa

  • Paraffin-embedded human breast tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymphoma tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for TRIM44 using ab236422 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (human epithelial cell line from cervix adenocarcinoma) cells transiently transfected with pCMV6-ENTRY TRIM44 stained for TRIM44 (green) using ab236422 at 1/100 dilution in ICC/IF.

References

ab236422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up