Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIM5 alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TRIM5 alpha aa 163-231.
    Sequence:

    IREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILK SLTNSETEMVQQTQSLREL


    Database link: Q9C035

  • Positive control

    • IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Isoform Alpha is a retrovirus restriction factor, which mediates species-specific, early block to retrovirus infection. Targets retroviral capsid soon after entry into the cell, and prevents reverse transcription of the virus RNA genome. Isoform Alpha trimers may make multiple contacts with the hexameric lattice of CA proteins which constitute the surface of retrovirion core, and somehow inactivate the virus. Restricts efficiently infection by N-MLV, but not HIV-1. May have E3 ubiquitin-protein ligase activity.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain

    The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme.
  • Post-translational
    modifications

    Ubiquitinates itself in a RING finger- and UBE2D2-dependent manner (in vitro).
  • Cellular localization

    Cytoplasm > P-body. Cytoplasmic bodies.
  • Information by UniProt
  • Database links

  • Alternative names

    • RING finger protein 88 antibody
    • RNF88 antibody
    • TRIM5 antibody
    • TRIM5_HUMAN antibody
    • TRIM5alpha antibody
    • Tripartite motif containing 5 antibody
    • tripartite motif protein TRIM5 antibody
    • Tripartite motif-containing protein 5 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for TRIM5 alpha using ab224446 at 1/200 dilution in immunohistochemical analysis.

References

ab224446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up