Overview

  • Product name

  • Description

    Mouse polyclonal to TRIO
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human TRIO aa 1961-2070. NP_009049.
    Sequence:

    ERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKG KDKIVFGNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIA YCQNKPKSEH


    Database link: O75962

  • Positive control

    • HeLa cell lysate; recombinant Human TRIO protein (immunogen).

Properties

Applications

Our Abpromise guarantee covers the use of ab194365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 347 kDa.

Target

  • Function

    Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, brain, pancreas, placenta, liver, kidney and lung.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 CRAL-TRIO domain.
    Contains 2 DH (DBL-homology) domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 PH domains.
    Contains 1 protein kinase domain.
    Contains 2 SH3 domains.
    Contains 4 spectrin repeats.
  • Domain

    The N-terminal DBL/GEF domain specifically catalyzes nucleotide exchange for RAC1, leading to the activation of Jun kinase and the production of membrane ruffles. The second DBL/GEF domain is an exchange factor for rhoa and induces the formation of stress fibers.
  • Post-translational
    modifications

    Phosphorylated on serine residue(s).
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGEF23 antibody
    • MEBAS antibody
    • MRD44 antibody
    • PTPRF-interacting protein antibody
    • tgat antibody
    • trio antibody
    • Trio Rho guanine nucleotide exchange factor antibody
    • TRIO_HUMAN antibody
    • Triple functional domain (PTPRF interacting) antibody
    • Triple functional domain protein antibody
    see all

Images

  • Anti-TRIO antibody (ab194365) at 1/500 dilution + HeLa cell lysate at 50 µg

    Predicted band size: 347 kDa

  • Anti-TRIO antibody (ab194365) at 1/1000 dilution + recombinant Human TRIO protein (immunogen) at 0.2 µg

    Predicted band size: 347 kDa



    Predicted MWt of immunogen: 38.21

References

ab194365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up