Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Zebrafish
  • Immunogen

    Recombinant fragment corresponding to Human TRIO aa 1816-1896.
    Sequence:

    KDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEGEEGAD AVPLPPPMAIQQHSLLQPDSQDDKASSRLLV


    Database link: O75962

  • Positive control

    • WB: RT-4 and U-251 MG cell lysates. ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 347 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, brain, pancreas, placenta, liver, kidney and lung.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 CRAL-TRIO domain.
    Contains 2 DH (DBL-homology) domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 PH domains.
    Contains 1 protein kinase domain.
    Contains 2 SH3 domains.
    Contains 4 spectrin repeats.
  • Domain

    The N-terminal DBL/GEF domain specifically catalyzes nucleotide exchange for RAC1, leading to the activation of Jun kinase and the production of membrane ruffles. The second DBL/GEF domain is an exchange factor for rhoa and induces the formation of stress fibers.
  • Post-translational
    modifications

    Phosphorylated on serine residue(s).
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGEF23 antibody
    • MEBAS antibody
    • MRD44 antibody
    • PTPRF-interacting protein antibody
    • tgat antibody
    • trio antibody
    • Trio Rho guanine nucleotide exchange factor antibody
    • TRIO_HUMAN antibody
    • Triple functional domain (PTPRF interacting) antibody
    • Triple functional domain protein antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH-SY5Y cells labeling TRIO with ab221176 at 4 µg/ml (green). 

  • All lanes : Anti-TRIO antibody (ab221176) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 347 kDa

References

ab221176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up