Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIOBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TRIOBP aa 2215-2348.
    Sequence:

    EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIAS QGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDK RFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRL


    Database link: Q9H2D6

  • Positive control

    • WB: PC-3, U-87 MG and Caco-2 cell lysates. IHC-P: Human heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 261 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    TRIOBP is a protein that interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. This trio binding protein also associates with F actin and stabilizes F actin structures.
  • Cellular localization

    Nucleus. Cytoplasm; cytoskeleton. Note: Localized to F-actin in a periodic pattern.
  • Database links

  • Alternative names

    • DFNB28 antibody
    • KIAA1662 antibody
    • Protein TARA antibody
    • TARA antibody
    • Tara like protein antibody
    • TRIO and F actin binding protein antibody
    • Trio and filamentous actin binding protein antibody
    • Trio associated repeat on actin antibody
    see all

Images

  • Paraffin-embedded human heart muscle tissue stained for TRIOBP using ab224226 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-TRIOBP antibody (ab224226) at 1/100 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) cell lysate
    Lane 2 : Caco-2 (human colorectal adenocarcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 261 kDa
    Additional bands at: 74 kDa (possible isoform)

  • Anti-TRIOBP antibody (ab224226) at 1/100 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 261 kDa
    Additional bands at: 74 kDa (possible isoform)

References

ab224226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up