Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIP-Br2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human TRIP-Br2 aa 36-85 (N terminal).
    Sequence:

    QRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPM


    Database link: NP_055570

  • Positive control

    • COLO205 cell lysate.
  • General notes

    Previously labelled as SERTAD2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab87150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-TRIP-Br2 antibody (ab87150) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 34 kDa
    Observed band size: ~34 kDa
    why is the actual band size different from the predicted?



    12% gel

References

This product has been referenced in:

  • Li C  et al. Nutrient/serum starvation derived TRIP-Br3 down-regulation accelerates apoptosis by destabilizing XIAP. Oncotarget 6:7522-35 (2015). WB . Read more (PubMed: 25691055) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up