Overview

  • Product name

  • Description

    Rabbit polyclonal to TRIP13/PCH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Dog, Pig, Zebrafish, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human TRIP13/PCH2 aa 219-324.
    Sequence:

    SKWFSESGKLVTKMFQKIQDLIDDKDALVFVLIDEVESLTAARNACRAGT EPSDAIRVVNAVLTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIK QY IGPPSA


    Database link: Q15645

  • Positive control

    • Human testis tissue; CACO2 cells; LY418122 lysate.
  • General notes

     This product was previously labelled as TRIP13

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of Paraffin-embedded Human testis tissue labeling TRIP13/PCH2 with ab204331 at 1/50 dilution.

References

This product has been referenced in:

  • Yao J  et al. Silencing TRIP13 inhibits cell growth and metastasis of hepatocellular carcinoma by activating of TGF-ß1/smad3. Cancer Cell Int 18:208 (2018). Read more (PubMed: 30564064) »
  • Zhou K  et al. Loss of thyroid hormone receptor interactor 13 inhibits cell proliferation and survival in human chronic lymphocytic leukemia. Oncotarget 8:25469-25481 (2017). WB ; Human . Read more (PubMed: 28424416) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up