Overview

  • Product name

    Anti-TRK fused gene antibody
    See all TRK fused gene primary antibodies
  • Description

    Rabbit polyclonal to TRK fused gene
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRK fused gene aa 196-400.
    Sequence:

    PSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQ QYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQP TSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPAS QPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQP GPGYR


    Database link: Q92734

  • Positive control

    • WB: Human intestine and kidney lysates. IHC-P: Human kidney and small intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab228435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 20 µg/ml.
WB Use a concentration of 1 - 2 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in TFG are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving TFG is found in thyroid papillary carcinomas. Translocation t(1;3)(q21;q11) with NTRK1. The TFG sequence is fused to the 3'-end of NTRK1 generating the TRKT3 (TRK-T3) fusion transcript.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ36137 antibody
    • HMSNP antibody
    • OTTHUMP00000214045 antibody
    • OTTHUMP00000214046 antibody
    • OTTHUMP00000214047 antibody
    • OTTHUMP00000214048 antibody
    • Protein TFG antibody
    • SPG57 antibody
    • TF6 antibody
    • TFG antibody
    • TFG_HUMAN antibody
    • TRK fused antibody
    • TRK fused gene antibody
    • TRK fused gene protein antibody
    • TRK-fused gene protein antibody
    • TRKT3 antibody
    • TRKT3 oncogene antibody
    see all

Images

  • Human kidney tissue stained for TRK fused gene using ab228435 at 20 µg/ml in immunohistochemical analysis.

  • Human small intestine tissue stained for TRK fused gene using ab228435 at 20 µg/ml in immunohistochemical analysis.

  • All lanes : Anti-TRK fused gene antibody (ab228435) at 1 µg/ml

    Lane 1 : Human intestine lysate
    Lane 2 : Human kidney lysate

    Predicted band size: 43 kDa

References

ab228435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up