Overview

  • Product name

  • Description

    Rabbit polyclonal to TRM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Cat, Dog, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla
  • Immunogen

    Synthetic peptide within Human TRM1 aa 500-550. The exact sequence is proprietary.
    Sequence:

    RCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLK R


    Database link: Q9NXH9

Properties

Applications

Our Abpromise guarantee covers the use of ab186019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • ab186019 at 1 µg/ml detecting TRM1 in 293T whole cell lysate by WB following IP.  ab186019 was used for IP at 6 µg/mg of lysate, 1 mg of lysate was used for IP and 20% of the IP was loaded.
    Detection: Chemiluminescence with an exposure time of 3 minutes.

References

ab186019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up