Overview

  • Product name

    Anti-TRNT1 antibody
  • Description

    Rabbit polyclonal to TRNT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TRNT1 aa 309-394.
    Sequence:

    LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDA TTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR


    Database link: Q96Q11

  • Positive control

    • WB: NIH/3T3, NBT-II and A549 cell lysates. IHC-P: Human stomach tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 50 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • AA408384 antibody
    • C76540 antibody
    • CCA adding antibody
    • CCA1 antibody
    • CGI 47 antibody
    • EC 2.7.7.25 antibody
    • Mitochondrial CCA adding tRNA nucleotidyltransferase antibody
    • Mitochondrial tRNA nucleotidyl transferase, CCA adding antibody
    • mt CCA adding enzyme antibody
    • mt Trat antibody
    • mt tRNA adenylyltransferase antibody
    • mt tRNA CCA diphosphorylase antibody
    • mt tRNA CCA pyrophosphorylase antibody
    • MtCCA antibody
    • MTO2 antibody
    • TRMU antibody
    • tRNA nucleotidyl transferase antibody
    • tRNA nucleotidyl transferase CCA adding 1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TRNT1 (green) using ab224536 at 4 µg/ml in ICC/IF.

  • Anti-TRNT1 antibody (ab224536) at 1/100 dilution + A549 (human lung carcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 50 kDa

  • Paraffin-embedded human stomach tissue stained for TRNT1 using ab224536 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-TRNT1 antibody (ab224536) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 50 kDa

References

ab224536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up