Overview

  • Product name

    Anti-Tropomodulin 3 antibody
    See all Tropomodulin 3 primary antibodies
  • Description

    Rabbit polyclonal to Tropomodulin 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse Tropomodulin 3 aa 1-352. (Expressed in E.coli).
    Sequence:

    MALPFRKDLGDYKDLDEDELLGKLSESELKQLETVLDDLDPENALLPAGF RQKNQTSKSATGPFDRERLLSYLEKQALEHKDRDDYVPYTGEKKGKIFIP KQKPAQTLTEETISLDPELEEALTSASDTELCDLAAILGMHNLIADTPFC DVLGSSNGVNQERFPNVVKGEKILPVFDEPPNPTNVEESLKRIRENDARL VEVNLNNIKNIPIPTLKDFAKTLEANTHVKHFSLAATRSNDPVAVAFADM LKVNKTLKSLNMESNFITGAGVLALIDALRDNETLMELKIDNQRQQLGTS VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRIEGD HQ


    Database link: Q9JHJ0

  • Positive control

    • IHC-P: Mouse kidney tissue. WB: Mouse pancreas, lung and heart lysates; Recombinant mouse Tropomodulin 3 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 50 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the tropomodulin family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • OTTHUMP00000162615 antibody
    • Tmod3 antibody
    • TMOD3_HUMAN antibody
    • Tropomodulin 3 (ubiquitous) antibody
    • Tropomodulin 3 ubiquitous antibody
    • Tropomodulin-3 antibody
    • U Tmod antibody
    • U-Tmod antibody
    • Ubiquitous tropomodulin antibody
    • UTmod antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for Tropomodulin 3 using ab232946 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Tropomodulin 3 antibody (ab232946) at 2 µg/ml + Recombinant mouse Tropomodulin 3 protein

    Predicted band size: 50 kDa

  • Anti-Tropomodulin 3 antibody (ab232946) at 1 µg/ml + Mouse pancreas lysate

    Predicted band size: 50 kDa

  • Anti-Tropomodulin 3 antibody (ab232946) at 1 µg/ml + Mouse lung lysate

    Predicted band size: 50 kDa

  • Anti-Tropomodulin 3 antibody (ab232946) at 1 µg/ml + Mouse heart lysate

    Predicted band size: 50 kDa

References

ab232946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Dog Cell lysate - whole cell (MDCK cells)
Gel Running Conditions
Reduced Denaturing (4-20% gradient gel)
Loading amount
100000 cells
Treatment
NS shRNA and TMOD3 targeting shRNA
Specification
MDCK cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Dr. Guillaume Charras

Verified customer

Submitted Nov 09 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up