Overview

  • Product name

    Anti-Tropomodulin 4 antibody
  • Description

    Rabbit polyclonal to Tropomodulin 4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Tropomodulin 4 aa 1-345.
    Sequence:

    MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLR QRDQTKKSPTGPLDREALLQYLEQQALEVKERDDLVPFTGEKKGKPYIQP KREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTLMSNKQYYDAL CSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEV NLNNIQDIPIPMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRE NRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGDAVEM EMATVLEQCPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR


    Database link: Q9NZQ9

  • Positive control

    • WB: Mouse muscle tissue lysate. IHC-P: Human skeletal muscle and breast cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 39 kDa (predicted molecular weight: 39, 32 kDa).

Target

  • Relevance

    Tropomodulin 4 prevents the elongation and depolymerization of the actin filaments at the pointed end, and intervenes in the formation of the short actin protofilament, which determines the structure of the membrane skeleton.
  • Cellular localization

    Cytoplasm, cytoskeleton.
  • Database links

  • Alternative names

    • Actin capping protein antibody
    • SK TMOD antibody
    • Sk-Tmod antibody
    • Skeletal muscle tropomodulin antibody
    • SKTMOD antibody
    • TMOD 4 antibody
    • TMOD4 antibody
    • Tropomodulin 4 (muscle) antibody
    • Tropomodulin-4 antibody
    see all

Images

  • Anti-Tropomodulin 4 antibody (ab229633) at 1/1000 dilution + Mouse muscle tissue lysate

    Secondary
    Goat anti-Rabbit at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 39, 32 kDa
    Observed band size: 39 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human skeletal muscle tissue stained for Tropomodulin 4 with ab229633 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for Tropomodulin 4 with ab229633 at 1/100 dilution in immunohistochemical analysis.

References

ab229633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up