Overview

  • Product name

    Anti-Tropomyosin 3 antibody
    See all Tropomyosin 3 primary antibodies
  • Description

    Rabbit polyclonal to Tropomyosin 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Tropomyosin 3 aa 28-173. The immunogen is also a 100% match to isoforms 3 and 6.
    Sequence:

    AERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKL EEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYE EVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSA


    Database link: P06753-2

  • Positive control

    • WB: THP-1, NIH/3T3 and NBT-II cell lysates. IHC-P: Human skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.
  • Involvement in disease

    Defects in TPM3 are the cause of nemaline myopathy type 1 (NEM1) [MIM:609284]. A form of nemaline myopathy with autosomal dominant or recessive inheritance. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-or rod-like structures in muscle fibers on histologic examination. Autosomal dominant nemaline myopathy type 1 is characterized by a moderate phenotype with onset between birth and early second decade of life. Weakness is diffuse and symmetric with slow progression often with need for a wheelchair in adulthood. The autosomal recessive form has onset at birth with moderate-to-severe hypotonia and diffuse weakness. In the most severe cases, death can occur before 2 years. Less severe cases have delayed major motor milestones, and these patients may walk, but often need a wheelchair before 10 years.
    Defects in TPM3 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving TPM3 is found in thyroid papillary carcinomas. A rearrangement with NTRK1 generates the TRK fusion transcript by fusing the amino end of isoform 2 of TPM3 to the 3'-end of NTRK1.
  • Sequence similarities

    Belongs to the tropomyosin family.
  • Domain

    The molecule is in a coiled coil structure that is formed by 2 polypeptide chains. The sequence exhibits a prominent seven-residues periodicity.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha tropomyosin 3 antibody
    • Alpha tropomyosin slow skeletal antibody
    • CFTD antibody
    • Cytoskeletal tropomyosin TM30 antibody
    • FLJ41118 antibody
    • gamma TM antibody
    • Gamma tropomyosin antibody
    • Gamma-tropomyosin antibody
    • Heat stable cytoskeletal protein 30 kDa antibody
    • hscp30 antibody
    • hTM30nm antibody
    • hTM5 antibody
    • hTMnm antibody
    • MGC102590 antibody
    • MGC14582 antibody
    • MGC3261 antibody
    • MGC72094 antibody
    • NEM1 antibody
    • OK/SW-cl.5 antibody
    • OTTHUMP00000034019 antibody
    • OTTHUMP00000034171 antibody
    • OTTHUMP00000034172 antibody
    • TM 5 antibody
    • TM-5 antibody
    • TM3 antibody
    • TM30 antibody
    • TM30nm antibody
    • TM5 antibody
    • Tm5NM antibody
    • Tpm 5 antibody
    • TPM3 antibody
    • TPM3/NTRK1 FUSION GENE, INCLUDED antibody
    • TPM3_HUMAN antibody
    • Tpm5 antibody
    • TPMsk3 antibody
    • TRK antibody
    • TRK ONCOGENE, INCLUDED antibody
    • Trop 5 antibody
    • Tropomyosin 3 antibody
    • Tropomyosin 3 gamma antibody
    • Tropomyosin 5 antibody
    • Tropomyosin alpha 3 chain antibody
    • Tropomyosin alpha-3 chain antibody
    • Tropomyosin gamma antibody
    • Tropomyosin-3 antibody
    • Tropomyosin-5 antibody
    see all

Images

  • Anti-Tropomyosin 3 antibody (ab224355) at 1/100 dilution + THP-1 (human monocytic leukemia cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 33 kDa

  • Paraffin-embedded human skeletal muscle tissue stained for Tropomyosin 3 using ab224355 at 1/50 in immunohistochemical analysis.

  • All lanes : Anti-Tropomyosin 3 antibody (ab224355) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 33 kDa

References

ab224355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up