Overview

  • Product name

  • Description

    Rabbit polyclonal to TROVE2/SS-A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, ELISA, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TROVE2/SS-A aa 3-535.
    Sequence:

    ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQK LGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQC SDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAI ADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYI TKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHR LVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVS LVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKA LDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMV VTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMI WAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMT SNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL


    Database link: P10155

  • Positive control

    • WB: HeLa, 293T, MCF7 and PC3 whole cell lysates and mouse heart, mouse spleen, mouse lung and rat kidney tissue lysates. IHC-P: Human kidney, human prostate and human liver tissues. ICC/IF: A549 and PC3 cells.
  • General notes

    Protein previously labeled as TROVE2.

Properties

Applications

Our Abpromise guarantee covers the use of ab194004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 61 kDa.

Target

  • Function

    RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. May stabilize these RNAs from degradation.
  • Sequence similarities

    Belongs to the Ro 60 kDa family.
    Contains 1 TROVE domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links

  • Alternative names

    • 60 kDa ribonucleoprotein Ro antibody
    • 60 kDa Ro protein antibody
    • 60 kDa SS A/Ro ribonucleoprotein antibody
    • 60 kDa SS-A/Ro ribonucleoprotein antibody
    • Autoantigen Ro/SSA, 60-KD antibody
    • bA101E13.2 antibody
    • Gastric cancer multi drug resistance protein antibody
    • Ribonucleoprotein autoantigen SS A/Ro antibody
    • RO 60 antibody
    • Ro 60 kDa autoantigen antibody
    • RO60 antibody
    • RO60_HUMAN antibody
    • RoRNP antibody
    • Sjoegren syndrome antigen A2 antibody
    • Sjoegren syndrome type A antigen antibody
    • Sjogren syndrome antigen A2 (60kD ribonucleoprotein autoantigen SS A/Ro) antibody
    • Sjogren syndrome antigen A2 (60kDa ribonucleoprotein autoantigen SS A/Ro) antibody
    • Sjogren syndrome antigen A2 antibody
    • SS A antibody
    • SS-A antibody
    • SS-A/Ro antibody
    • SSA 2 antibody
    • SSA antibody
    • SSA2 antibody
    • TROVE 2 antibody
    • TROVE domain family member 2 antibody
    • TROVE2 antibody
    see all

Images

  • All lanes : Anti-TROVE2/SS-A antibody (ab194004) at 3 µg/ml

    Lane 1 : MCF-7 whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : PC3 whole cell lysate
    Lane 4 : Mouse heart tissue
    Lane 5 : Mouse spleen tissue
    Lane 6 : Mouse lung tissue

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/5000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa

  • Immunocytochemistry/ Immunofluorescence analysis of A549 cells labeling TROVE2/SS-A with ab194004 at 1/100 dilution. 

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling TROVE2/SS-A with ab194004 at dilution of 1/100.

  • All lanes : Anti-TROVE2/SS-A antibody (ab194004) at 2 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit at 1/10000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa

  • Immunocytochemistry/Immunofluorescence analysis of PC3 cells labelling TROVE2/SS-A with ab194004 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

  • Immunohistochemical analysis of paraffin-embedded Human prostate tissue labeling TROVE2/SS-A with ab194004 at 1/20 dilution.

  • All lanes : Anti-TROVE2/SS-A antibody (ab194004) at 3.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : Rat kidney tissue lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling TROVE2/SS-A with ab194004 at 1/20 dilution.

References

ab194004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up