Overview

  • Product name

  • Description

    Rabbit polyclonal to TROVE2/SS-A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TROVE2/SS-A aa 371-506.
    Sequence:

    FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDN ETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGF


    Database link: P10155

  • Positive control

    • WB: RT-4 and U-251 MG cell lysate; human liver and tonsil tissue lysate. ICC/IF: U-251 MG cells.
  • General notes

    Protein previously labeled as TROVE2.

Properties

Applications

Our Abpromise guarantee covers the use of ab219973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 61 kDa.

Target

  • Function

    RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. May stabilize these RNAs from degradation.
  • Sequence similarities

    Belongs to the Ro 60 kDa family.
    Contains 1 TROVE domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links

  • Alternative names

    • 60 kDa ribonucleoprotein Ro antibody
    • 60 kDa Ro protein antibody
    • 60 kDa SS A/Ro ribonucleoprotein antibody
    • 60 kDa SS-A/Ro ribonucleoprotein antibody
    • Autoantigen Ro/SSA, 60-KD antibody
    • bA101E13.2 antibody
    • Gastric cancer multi drug resistance protein antibody
    • Ribonucleoprotein autoantigen SS A/Ro antibody
    • RO 60 antibody
    • Ro 60 kDa autoantigen antibody
    • RO60 antibody
    • RO60_HUMAN antibody
    • RoRNP antibody
    • Sjoegren syndrome antigen A2 antibody
    • Sjoegren syndrome type A antigen antibody
    • Sjogren syndrome antigen A2 (60kD ribonucleoprotein autoantigen SS A/Ro) antibody
    • Sjogren syndrome antigen A2 (60kDa ribonucleoprotein autoantigen SS A/Ro) antibody
    • Sjogren syndrome antigen A2 antibody
    • SS A antibody
    • SS-A antibody
    • SS-A/Ro antibody
    • SSA 2 antibody
    • SSA antibody
    • SSA2 antibody
    • TROVE 2 antibody
    • TROVE domain family member 2 antibody
    • TROVE2 antibody
    see all

Images

  • All lanes : Anti-TROVE2/SS-A antibody (ab219973) at 1/100 dilution

    Lane 1 : RT-4 cell line lysate
    Lane 2 : U-251 MG cell line lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 61 kDa

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized U-251 MG cells labeling TROVE2/SS-A with ab219973 at 4 μg/mL dilution (green).

References

ab219973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up