Overview

  • Product name

  • Description

    Rabbit polyclonal to TRP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal amino acids 396-445 (

    NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP

    ) of Human TRP1 (NP_000541).

  • Positive control

    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
ICC/IF Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa.Can be blocked with Recombinant Human TRP1 protein (His tag) (ab219285). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. May regulate or influence the type of melanin synthesized.
  • Tissue specificity

    Pigment cells.
  • Pathway

    Pigment biosynthesis; melanin biosynthesis.
  • Involvement in disease

    Defects in TYRP1 are the cause of albinism oculocutaneous type 3 (OCA3) [MIM:203290]; also known as Rufous oculocutaneous albinism. An autosomal recessive disorder in which the biosynthesis of melanin pigment is reduced in skin, hair, and eyes. Tyrosinase activity is normal and patients have only moderate reduction of pigment. The eyes present red reflex on transillumination of the iris, dilution of color of iris, nystagmus and strabismus. Darker-skinned individuals have bright copper-red coloration of the skin and hair.
  • Sequence similarities

    Belongs to the tyrosinase family.
  • Cellular localization

    Melanosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 antibody
    • 5,6 dihydroxyindole 2 carboxylic acid oxidase antibody
    • 6-dihydroxyindole-2-carboxylic acid oxidase antibody
    • b-PROTEIN antibody
    • CAS2 antibody
    • Catalase B antibody
    • CATB antibody
    • DHICA oxidase antibody
    • Glycoprotein 75 antibody
    • GP75 antibody
    • Melanoma antigen gp75 antibody
    • OCA3 antibody
    • TRP antibody
    • TRP-1 antibody
    • TRP1 antibody
    • Tyrosinase related protein 1 antibody
    • Tyrosinase-related protein 1 antibody
    • TYRP antibody
    • TYRP1 antibody
    • TYRP1_HUMAN antibody
    • TYRRP antibody
    see all

Images

  • Anti-TRP1 antibody (ab83774) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa



    Gel concentration 12%
  • ab83774 staining TRP1 in human melanoma MNT-1 cells by Immunocytochemistry/ Immunofluorescence. The cells were fixed in paraformaldehyde, permeabilised in 0.1% Triton X-100 and then blocked using 1% BSA for 1 hour at 22°C. Samples were then incubated with primary antibody at 1/100 for 16 hours at 4°C. The secondary antibody used was a goat anti-rabbit IgG (H+L) conjugated to Alexa Fluor® 594 (red) used at a 1/1000 dilution.

    See Abreview

  • ab83774 at 5 µg/ml staining TRP1 in Human skin by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

References

This product has been referenced in:

  • Wu CC  et al. In situ quantification of individual mRNA transcripts in melanocytes discloses gene regulation of relevance to speciation. J Exp Biol 222:N/A (2019). Read more (PubMed: 30718374) »
  • Coste C  et al. Human bone marrow harbors cells with neural crest-associated characteristics like human adipose and dermis tissues. PLoS One 12:e0177962 (2017). ICC/IF . Read more (PubMed: 28683107) »
See all 5 Publications for this product

Customer reviews and Q&As

1-10 of 11 Abreviews or Q&A

Western blot

Inconclusive
Abreviews
Application
Western blot
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing
Sample
Mouse Tissue lysate - whole (epidermis)
Specification
epidermis
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: RT°C

Abcam user community

Verified customer

Submitted May 29 2013

Answer

Thank you for your phone call. I have created the following discount codes for you:


DISCOUNT CODE: xxx for ab83774
DISCOUNT CODE: xxx for ab103463
DISCOUNT CODE: xxx for ab46545

Expiration date: xxx

I am very pleased to hear you would like to accept our offer and test ab83774, ab103463 and ab46545 in dog. Each code will give you: 1 free PRIMARY ANTIBODYbefore the expiration date. To redeem this offer, please submit an Abreview for dogand include this code in the “Additional Comments” section so we know the Abreview is for this promotion. Please remember that submission of the Abreview is sufficient for the discount code to become active.
For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: https://www.abcam.com/collaborationdiscount.

Read More

Answer

Merci pour votre courriel.

Veuillez trouver la SDS en document attaché. Vous pouvez dès maintenant aussi la télécharger depuis la fiche technique si vous souhaitez par le lien à droite, sous le lien "get pdf". https://www.abcam.com/index.html?datasheet=83774 (or use the following: https://www.abcam.com/index.html?datasheet=83774).

J'espère que ceci vous est utile. Veuillez ne pas hésiter à nous recontacter si vous avez besoin d'autre renseignements.

Read More

Answer

Merci de nous avoir contactés.

Les FDS (ou MSDS) sont disponiblesdirectement depuis les fiches techniques de nos produits:
https://www.abcam.com/ab83774
https://www.abcam.com/ab14509

Comme expliqué dans mes précédents emails, si il n'y a pas de FDS associé à un produit (ab83774 par exemple) c'est que ce produit ne contient aucun produit dangereux et ne nécessite donc pas un tel document.

J'espère que ces informations vous seront utiles. N'hésitez pas à nous contacter de nouveau si vous avez d'autres questions.

Read More
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Dog Tissue sections (melanoma (oral))
Specification
melanoma (oral)
Fixative
Formaldehyde
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10 mM citrate buffer, pH6.0
Permeabilization
No
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 2.5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jun 21 2012

Application
Western blot
Sample
Human Cell lysate - whole cell (A375 melanoma cell line)
Loading amount
10000 cells
Specification
A375 melanoma cell line
Gel Running Conditions
Reduced Denaturing (10% acrylamide)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted May 31 2012

Answer

It was nice speaking to you on the phone too!

I am very happy to hear thay you would like to take up my offer of testing ab104864 and ab83774 with your human and mouse samples respectively. I have generated the testing discount codes as below:

ab104864 discount code: xxxxxx expiration date: 5th August 2012

ab83774 discount code: xxxxxxx expiration date: 5th August 2012

In order to claim your "free" primary antibodies, please submit Abreviews for ab104864 and ab83774, quoting the relevant disocunt code in the "Additional comments" section. Once the Abreview has been published your code will become active and can be used when placing an order for a primary antibody from our catalogue. This can be done by:

1) Calling to place your order and mention the code to our customer service department;
2) Include the code in your fax order;
3) Place your order on the web and enter the promotional code.

For more information on how to submit an Abreview, please visit the site:

https://www.abcam.com/Abreviews.

The terms and conditions applicable to this offer can be found here:

https://www.abcam.com/collaborationdiscount.

I really hope the antibodies work well for you. If you do have any problems please do let us know as we can quite often offeruseful advice on how to optimise protocols in order to get the most out of the antibody.

I wish you all the best with your research.

Read More

Question
Answer

Thank you for contacting us in regards to antibodies ab104864, ab83774 and ab52493.

As discussed over the phone, the western blot presented on the datasheet of Anti-Hyaluronan synthase 1 antibody [3E10] (ab104864) was performed using the recombinantly expressed truncated human Hyaluronan synthase protein (residues 70-243). This explains why the band detected is not of the size expected (˜65 kDa). As we discussed, this does however mean that you would be eligible for the testing discount scheme. As this antibody has currently not been validated in detecting endogenously expressed protein, I would be able to apply this offer to you if you would be willing to share the results obtained with using ab104864.

This scheme would involve you purchasing ab104864 as normal, testing it in western blotting to detect the endogenously expressed human protein, then sharing the results obtained (including an image of the results) through an Abreview. This should only take 5-10 minutes and regardless of if the results are positive or negative you would be rewarded with a free primary antibody of your choice from our catalogue. The only constraint to this scheme is that the antibody to be tested needs to be purchased, tested and the "free" antibody claimed within 4 months. More information on this scheme can be found from the following link:

https://www.abcam.com/collaboratordiscount

If you would like to participate in this scheme please do let me know as a discount code needs to be issued prior to purchasing ab104864.

As for anti-TRP1 antibody (ab83774), you mentioned that you wanted to use this antibody for detecting the TRP1 protein in mouse sample by western blotting. As discussed over the phone, this antibody has not been tested with mouse samples, however, the immunogen used to raise this antibody shares 100% homology with the mouse protein and we would therefore expect the antibody to detect the murine TRP1 protein. Again, if you would like to test this antibody in mouse samples and share the results with us you would be eligible for the testing discount scheme. Alternatively, mouse monoclonal https://www.abcam.com/TRP1-antibody-TA99-ab3312.htmlhas been used to detect the murine protein and would therefore be covered by the Abpromise for theexperiment you wish to perform.

The anti-Tyrosinase antibody [EP1577Y] (ab52493) has been validated with mouse samples and with western blotting and should therefore work in the experiment you are planning. This antibody would be covered by the Abpromise if you have any problems. More information on this guarantee can be found from the following link:

https://www.abcam.com/abpromise

I hope this information has been of help. If you have any further questions please do not hesitate to contact us again.

Read More

Question
Answer

Thank you very much for your interest in ab83774. To our knowledge, ab83774 has not been tested in mouse. Therefore, I can offer a discount off a future purchase if you buy ab83774 now, test it in mouse and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and test ab83774 in mouse. I will then send a discount code. This code must be issued before purchasing ab83774 so please wait for my reply before ordering. 2. Purchase ab83774 either by phone, fax, or online (www.abcam.com). 3. Test it in mouse. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue. We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab83774 turns out to be unsuitable for mouse, you will still receive the discount on your next purchase after your Abreview has been submitted. Please let me know if you have any questions about this offer and I would be happy to help you further. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.  

Read More
Application
Western blot
Sample
Human Cell lysate - whole cell (human melanoma line MNT-1)
Loading amount
20 µg
Specification
human melanoma line MNT-1
Treatment
control (C) or WIPI1 (W) siRNA
Gel Running Conditions
Reduced Denaturing
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Ms. Hsiang Ho

Verified customer

Submitted May 05 2011

1-10 of 11 Abreviews or Q&A

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up