Overview

  • Product name

    Anti-TRP14 antibody
  • Description

    Rabbit polyclonal to TRP14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRP14 aa 1-62.
    Sequence:

    MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAE PVVREGLKHISE

  • Positive control

    • Human cerebellum tissue; RT4, U251 MG cell lysates.
  • General notes

    Previously labelled as TXNDC17.

Properties

Applications

Our Abpromise guarantee covers the use of ab121725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.

Target

  • Function

    Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.
  • Tissue specificity

    Ubiquitously expressed in cell lines.
  • Sequence similarities

    Belongs to the thioredoxin family.
    Contains 1 thioredoxin domain.
  • Post-translational
    modifications

    The oxidized protein is reduced by TRXR1.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 14 kDa thioredoxin-related protein antibody
    • Protein 42-9-9 antibody
    • Thioredoxin domain-containing protein 17 antibody
    • Thioredoxin-like protein 5 antibody
    • TRP14 antibody
    • TXD17_HUMAN antibody
    • TXNDC17 antibody
    see all

Images

  • ab121725 at 1/500 dilution staining TRP14 in Paraffin-embedded Human cerebellum tissue by Immunohistochemistry.

  • All lanes : Anti-TRP14 antibody (ab121725) at 1/250 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human Liver tissue lysate
    Lane 5 : Human Tonsil tissue lysate

    Developed using the ECL technique.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up