Overview

  • Product name

  • Description

    Rabbit polyclonal to TRP2/DCT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment corresponding to Human TRP2/DCT aa 252-401.
    Sequence:

    NECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNG TYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNAL EGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDA


    Database link: P40126

  • Positive control

    • IHC: Human skin tissue. WB: Recombinant TRP2/DCT overexpressing HEK-293T lysate.
  • General notes

    Previously labelled as TRP2

Properties

Applications

Our Abpromise guarantee covers the use of ab223736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 59 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in regulating eumelanin and phaeomelanin levels.
  • Pathway

    Pigment biosynthesis; melanin biosynthesis.
  • Sequence similarities

    Belongs to the tyrosinase family.
  • Cellular localization

    Melanosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • L dopachrome tautomerase antibody
    • DCT antibody
    • Dopachrome delta isomerase antibody
    • Dopachrome tautomerase antibody
    • Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2 antibody
    • DT antibody
    • EC 5.3.3.12 antibody
    • L dopachrome Delta isomerase antibody
    • L-dopachrome Delta-isomerase antibody
    • L-dopachrome tautomerase antibody
    • TRP 2 antibody
    • TRP-2 antibody
    • TRP2 antibody
    • Tyrosinase related protein 2 antibody
    • Tyrosinase-related protein 2 antibody
    • TYRP2 antibody
    • TYRP2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human skin tissue stained for TRP2/DCT using ab223736 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-TRP2/DCT antibody (ab223736) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293 (human epithelial cell line from embryonic kidney) lysate (negative control)
    Lane 2 : Recombinant TRP2/DCT overexpressing HEK-293 (Human epithelial cell line from embryonic kidney) co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) lysate

    Predicted band size: 59 kDa

References

ab223736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up