Overview

  • Product name

  • Description

    Rabbit polyclonal to TRPC5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human TRPC5 aa 764-973.
    Sequence:

    RKHPRSFSTSSTELSQRDDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPL IRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEP MYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEINLSEVELGEVQGAA QSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGD GQEEQVTTRL


    Database link: Q9UL62

  • Positive control

    • IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Has also been shown to be calcium-selective (By similarity). May also be activated by intracellular calcium store depletion.
  • Tissue specificity

    Expressed in brain with higher levels in fetal brain. Found in cerebellum and occipital pole.
  • Sequence similarities

    Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC5 sub-subfamily.
    Contains 4 ANK repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Htrp 5 antibody
    • Htrp-5 antibody
    • Htrp5 antibody
    • Short transient receptor potential channel 5 antibody
    • Transient receptor potential cation channel subfamily C member 5 antibody
    • Transient receptor potential channel 5 antibody
    • Transient receptor protein 5 antibody
    • TRP 5 antibody
    • TRP-5 antibody
    • TRP5 antibody
    • TRPC 5 antibody
    • TrpC5 antibody
    • TRPC5_HUMAN antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for TRPC5 using ab230216 at 1/100 dilution in immunohistochemical analysis.

References

ab230216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up