Overview

  • Product name

  • Description

    Rabbit polyclonal to TRPC6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human TRPC6 aa 1-192. (Expressed in E.coli).
    Sequence:

    MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC YGYYPCFRGSDNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEE RFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITE LLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRL


    Database link: Q9Y210

  • Positive control

    • IHC-P: Human kidney, placenta, stomach and testis tissues. WB: Human serum; Pig cerebrum lysate; Recombinant human TRPC6 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233413 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 106 kDa.

Target

  • Function

    Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C. Seems not to be activated by intracellular calcium store depletion.
  • Tissue specificity

    Expressed primarily in placenta, lung, spleen, ovary and small intestine. Expressed in podocytes and is a component of the glomerular slit diaphragm.
  • Involvement in disease

    Defects in TRPC6 are the cause of focal segmental glomerulosclerosis type 2 (FSGS2) [MIM:603965]. A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation.
  • Sequence similarities

    Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC6 sub-subfamily.
    Contains 4 ANK repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • bZ1P14.9 antibody
    • FLJ11098 antibody
    • FLJ14863 antibody
    • FSGS2 antibody
    • MTRP6 antibody
    • Short transient receptor potential channel 6 antibody
    • si:rp71-1p14.9 antibody
    • Transient receptor potential cation channel subfamily C member 6 antibody
    • Transient receptor protein 6 antibody
    • TRP 6 antibody
    • TRP-6 antibody
    • TRP6 antibody
    • TRPC 6 antibody
    • Trpc6 antibody
    • TRPC6_HUMAN antibody
    • TRRP6 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for TRPC6 using ab233413 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Paraffin-embedded human kidney tissue stained for TRPC6 using ab233413 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human placenta tissue stained for TRPC6 using ab233413 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Paraffin-embedded human stomach tissue stained for TRPC6 using ab233413 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TRPC6 antibody (ab233413) at 2 µg/ml + Recombinant human TRPC6 protein

    Predicted band size: 106 kDa

  • Anti-TRPC6 antibody (ab233413) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 106 kDa

  • Anti-TRPC6 antibody (ab233413) at 2 µg/ml + Human serum

    Predicted band size: 106 kDa

  • Formalin-fixed, paraffin-embedded human testis tissue stained for TRPC6 using ab233413 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab233413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up