Overview

  • Product name

    Anti-TRPM1 antibody
  • Description

    Rabbit polyclonal to TRPM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRPM1 aa 1253-1365.
    Sequence:

    CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTC SFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEES KLGPDIGISKEDD


    Database link: Q7Z4N2-1

  • Positive control

    • IHC-P: Human retina tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab219965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Cation channel essential for the depolarizing photoresponse of retinal ON bipolar cells. It is part of the GRM6 signaling cascade. May play a role in metastasis suppression (By similarity). May act as a spontaneously active, calcium-permeable plasma membrane channel.
  • Tissue specificity

    Expressed in the retina where it localizes to the outer plexiform layer. Highly expressed in benign melanocytic nevi and diffusely expressed in various in situ melanomas, but not detected in melanoma metastases. Also expressed in melanocytes and pigmented metastatic melanoma cell lines. In melanocytes expression appears to be regulated at the level of transcription and mRNA processing.
  • Involvement in disease

    Defects in TRPM1 are the cause of congenital stationary night blindness type 1C (CSNB1C) [MIM:613216]. A non-progressive retinal disorder characterized by impaired night vision, often associated with nystagmus and myopia.
  • Sequence similarities

    Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM1 sub-subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CSNB1C antibody
    • Long transient receptor potential channel 1 antibody
    • LTrpC1 antibody
    • Melastatin 1 antibody
    • Melastatin-1 antibody
    • MLSN1 antibody
    • Transient receptor potential cation channel subfamily M member 1 antibody
    • Transient receptor potential cation channel, subfamily M, member 1 antibody
    • Transient receptor potential melastatin family antibody
    • TRPM1 antibody
    • TRPM1 protein antibody
    • TRPM1_HUMAN antibody
    • Weakly similar to F54D1.5 [C.elegans] antibody
    see all

Images

  • Paraffin embedded human retina tissue tissue stained for TRPM1 with ab219965 (1/500 dilution) in immunohistochemical analysis.

References

ab219965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up