Overview

  • Product name

    Anti-TRPM4 antibody [OTI10H5]
    See all TRPM4 primary antibodies
  • Description

    Mouse monoclonal [OTI10H5] to TRPM4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Dog, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human TRPM4 aa 1-1214. Produced in HEK-293T cells (NP_060106).
    Sequence:

    MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAME DAFGAAVVTVWDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPA AVYSLVTRTWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRRGLVRAAQSTG AWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVRNRDTL INPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTHGCLGGENRFR LRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLL VAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQ VERIMTRKELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLA VAWNRVDIAQSELFRGDIQWRSFHLEASLMDALLNDRPEFVRLLISHGLS LGHFLTPMRLAQLYSAAPSNSLIRNLLDQASHSAGTKAPALKGGAAELRP PDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLLSDKATSPLSL DAGLGQAPWSDLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA RLEPDAEEAARRKDLAFKFEGMGVDLFGECYRSSEVRAARLLLRRCPLWG DATCLQLAMQADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCP PLIYTRLITFRKSEEEPTREELEFDMDSVINGEGPVGTADPAEKTPLGVP RQSGRPGCCGGRCGGRRCLRRWFHFWGAPVTIFMGNVVSYLLFLLLFSRV LLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSLASGGPGPGHA SLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFM VFTVRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEG LLRPRDSDFPSILRRVFYRPYLQIFGQIPQEDMDVALMEHSNCSSEPGFW AHPPGAQAGTCVSQYANWLVVLLLVIFLLVANILLVNLLIAMFSYTFGKV QGNSDLYWKAQRYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSPQ PSSPALEHFRVYLSKEAERKLLTWESVHKENFLLARARDKRESDSERLKR TSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVAEALSRSALLP PGGPPPPDLPGSKD


    Database link: Q8TD43

  • Positive control

    • WB: HEK-293T cells transfected with pCMV6-ENTRY TRPM4 cDNA; HepG2, HeLa, HT-29, COS-7, Jurkat, MDCK and MCF7 cell extracts. IHC-P: Human kidney, liver, liver carcinoma, ovary and pancreas tissues.
  • General notes

    Clone OTI10H5 (formerly 10H5).

Properties

Applications

Our Abpromise guarantee covers the use of ab123936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/5000 - 1/10000. Predicted molecular weight: 134 kDa.
IHC-P 1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    Calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca(2+), it is impermeable to it. Mediates transport of monovalent cations (Na(+) > K(+) > Cs(+) > Li(+)), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca(2+) oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. Involved in myogenic constriction of cerebral arteries. Controls insulin secretion in pancreatic beta-cells. May also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca(2+) overload. Affects T-helper 1 (Th1) and T-helper 2 (Th2) cell motility and cytokine production through differential regulation of calcium signaling and NFATC1 localization. Enhances cell proliferation through up-regulation of the beta-catenin signaling pathway.
  • Tissue specificity

    Widely expressed with a high expression in intestine and prostate. In brain, it is both expressed in whole cerebral arteries and isolated vascular smooth muscle cells. Prominently expressed in Purkinje fibers. Expressed at higher levels in T-helper 2 (Th2) cells as compared to T-helper 1 (Th1) cells.
  • Involvement in disease

    Defects in TRPM4 are the cause of progressive familial heart block type 1B (PFHB1B) [MIM:604559]. It is a cardiac bundle branch disorder characterized by progressive alteration of cardiac conduction through the His-Purkinje system, with a pattern of a right bundle-branch block and/or left anterior hemiblock occurring individually or together. It leads to complete atrio-ventricular block causing syncope and sudden death.
  • Sequence similarities

    Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM4 sub-subfamily.
  • Post-translational
    modifications

    Phosphorylation by PKC leads to increase the sensitivity to Ca(2+).
    Sumoylated. Desumoylated by SENP1.
  • Cellular localization

    Endoplasmic reticulum. Golgi apparatus and Cell membrane. Endoplasmic reticulum. Golgi apparatus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110030C19Rik antibody
    • AW047689 antibody
    • Calcium-activated non-selective cation channel 1 antibody
    • FLJ20041 antibody
    • hTRPM4 antibody
    • Long transient receptor potential channel 4 antibody
    • LTrpC-4 antibody
    • LTrpC4 antibody
    • Melastatin 4 antibody
    • Melastatin like 2 protein antibody
    • Melastatin-4 antibody
    • Melastatin-like 2 antibody
    • Mls2s antibody
    • PFHB1B antibody
    • Transient receptor potential cation channel subfamily M member 4 antibody
    • Transient receptor potential cation channel, subfamily M, member 4 antibody
    • Trpm4 antibody
    • TRPM4_HUMAN antibody
    • TRPM4B antibody
    see all

Images

  • All lanes : Anti-TRPM4 antibody [OTI10H5] (ab123936) at 1/5000 dilution

    Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : HT-29 (Human colorectal adenocarcinoma cell line) cell extract
    Lane 4 : A549 (Human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (Human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (Canine kidney cell line) cell extract
    Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 134 kDa

  • Paraffin-embedded human kidney tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • Paraffin-embedded human liver tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • Paraffin-embedded human liver carcinoma tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • Paraffin-embedded human ovary tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • Paraffin-embedded human pancreas tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • All lanes : Anti-TRPM4 antibody [OTI10H5] (ab123936) at 1/5000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY TRPM4 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 134 kDa

References

ab123936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up