Overview

  • Product name

  • Description

    Rabbit polyclonal to TRPM7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human TRPM7 aa 800-850 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFY H


    Database link: Q96QT4

  • Positive control

    • Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Essential ion channel and serine/threonine-protein kinase. Divalent cation channel permeable to calcium and magnesium. Has a central role in magnesium ion homeostasis and in the regulation of anoxic neuronal cell death. The kinase activity is essential for the channel function. May be involved in a fundamental process that adjusts plasma membrane divalent cation fluxes according to the metabolic state of the cell. Phosphorylates annexin A1 (ANXA1).
  • Involvement in disease

    Defects in TRPM7 are a cause of susceptibility to amyotrophic lateral sclerosis-parkinsonism/dementia complex type 1 (ALS-PDC1) [MIM:105500]; also called amyotrophic lateral sclerosis-parkinsonism/dementia complex of Guam or Guam disease. Amyotrophic lateral sclerosis-parkinsonism/dementia complex type 1 is a neurodegenerative disorder characterized by chronic, progressive and uniformly fatal amyotrophic lateral sclerosis and parkinsonism-dementia. Both diseases are known to occur in the same kindred, the same sibship and even the same individual.
  • Sequence similarities

    In the C-terminal section; belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.
    In the N-terminal section; belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM7 sub-subfamily.
    Contains 1 alpha-type protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALSPDC antibody
    • CHAK antibody
    • CHAK1 antibody
    • Channel kinase 1 antibody
    • Channel-kinase 1 antibody
    • Long transient receptor potential channel 7 antibody
    • LTrpC-7 antibody
    • LTrpC7 antibody
    • Transient receptor potential cation channel subfamily M member 7 antibody
    • TRP PLIK antibody
    • TRPM7 antibody
    • TRPM7_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling TRPM7 with ab217938 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up