Overview

  • Product name

    Anti-TRPML3 antibody
  • Description

    Rabbit polyclonal to TRPML3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human TRPML3 aa 216-265 (internal sequence).
    Sequence:

    VELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDIS


    Database link: NP_060768

  • Positive control

    • PANC1 cell lysate
  • General notes

    Previously labelled as Mucolipin 3.

Properties

Applications

Our Abpromise guarantee covers the use of ab94732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-TRPML3 antibody (ab94732) at 1 µg/ml (in 5% skim milk / PBS buffer) + PANC1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 64 kDa



    Gel concentration: 12%

References

ab94732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up