Overview

  • Product name
  • Description
    Rabbit polyclonal to TRPS1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TRPS1 aa 1-50 (N terminal). The exact sequence is proprietary. AAG21134.1
    Sequence:

    MVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTDQSD


    Database link: Q9UHF7

  • Positive control
    • HeLa, Jurkat, 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 142 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Transcriptional repressor. Binds specifically to GATA sequences and represses expression of GATA-regulated genes at selected sites and stages in vertebrate development. Regulates chondrocyte proliferation and differentiation. Executes multiple functions in proliferating chondrocytes, expanding the region of distal chondrocytes, activating proliferation in columnar cells and supporting the differentiation of columnar into hypertrophic chondrocytes.
  • Tissue specificity
    Ubiquitously expressed in the adult. Found in fetal brain, lung, kidney, liver, spleen and thymus. More highly expressed in androgen-dependent than in androgen-independent prostate cancer cells.
  • Involvement in disease
    Defects in TRPS1 are the cause of tricho-rhino-phalangeal syndrome type 1 (TRPS1) [MIM:190350]. TRPS1 is an autosomal dominant disorder characterized by craniofacial and skeletal abnormalities. It is allelic with tricho-rhino-phalangeal type 3. Typical features include sparse scalp hair, a bulbous tip of the nose, protruding ears, a long flat philtrum and a thin upper vermilion border. Skeletal defects include cone-shaped epiphyses at the phalanges, hip malformations and short stature.
    Defects in TRPS1 are a cause of tricho-rhino-phalangeal syndrome type 2 (TRPS2) [MIM:150230]. A syndrome that combines the clinical features of trichorhinophalangeal syndrome type 1 and multiple exostoses type 1. Affected individuals manifest multiple dysmorphic facial features including large, laterally protruding ears, a bulbous nose, an elongated upper lip, as well as sparse scalp hair, winged scapulae, multiple cartilaginous exostoses, redundant skin, and mental retardation. Note=A chromosomal aberration resulting in the loss of functional copies of TRPS1 and EXT1 has been found in TRPS2 patients.
    Defects in TRPS1 are the cause of tricho-rhino-phalangeal syndrome type 3 (TRPS3) [MIM:190351]. TRPS3 is an autosomal dominant disorder characterized by craniofacial and skeletal abnormalities. It is allelic with tricho-rhino-phalangeal type 1. In TRPS3 a more severe brachydactyly and growth retardation are observed.
  • Sequence similarities
    Contains 7 C2H2-type zinc fingers.
    Contains 1 GATA-type zinc finger.
  • Post-translational
    modifications
    Sumoylated. Sumoylation in the repressor domain inhibits the transcription repression activity. Sumoylation on Lys-1201 is the major site. Appears to be sumoylated on multiple sites.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • GC79 antibody
    • LGCR antibody
    • Transcriptional repressor GATA binding 1 antibody
    • Tricho rhino phalangeal syndrome I antibody
    • Tricho-rhino-phalangeal syndrome type I protein antibody
    • Trichorhinophalangeal syndrome I antibody
    • Trichorhinophalangeal syndrome I homolog antibody
    • TRPS 1 antibody
    • trpS1 antibody
    • TRPS1 gene antibody
    • TRPS1_HUMAN antibody
    • Zinc finger protein GC79 antibody
    • Zinc finger transcription factor TRPS 1 antibody
    • Zinc finger transcription factor Trps1 antibody
    see all

Images

  • All lanes : Anti-TRPS1 antibody (ab176712) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 142 kDa


    Exposure time: 30 seconds
  • TRPS1 was immunoprecipitated from 1mg HeLa whole cell lysate using ab176712 at 6 μg/mg lysate (Lane 1), a rabbit anti-TRPS1 antibody recognizing a downstream epitope of TRPS1 (Lane 2) or control IgG (Lane 3). 20% of the Immunoprecipitate was loaded per lane and then immunobotted using ab176712 at 0.4 μg/ml.

    Detection:

    Chemiluminescence with exposure times of 10 seconds.

References

ab176712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up