Overview

  • Product name

  • Description

    Rabbit polyclonal to TRPT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRPT1 aa 110-184.
    Sequence:

    VPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGL PGDPGIISGMRSHCEIAVFIDGPLA


    Database link: Q86TN4

  • Positive control

    • IHC-P: Human liver tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.
  • Tissue specificity

    Widely expressed. Weakly or not expressed in lung, spleen, small intestine and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the kptA/TPT1 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC11134 antibody
    • tRNA 2''-phosphotransferase 1 antibody
    • tRNA phosphotransferase 1 antibody
    • tRNA splicing 2' phosphotransferase 1 antibody
    • trpt1 antibody
    • TRPT1_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for TRPT1 using ab243718 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TRPT1 (green) using ab243718 at 4 µg/ml in ICC/IF.

References

ab243718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up