Overview

  • Product name

  • Description

    Rabbit polyclonal to TRPV2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRPV2 aa 1-117.
    Sequence:

    MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKF APQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSK TSKYLTDSEYTEGSTGK


    Database link: Q9Y5S1

  • Positive control

    • IHC-P: Human prostate tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as VRL1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/500.
IHC-P 1/500 - 1/1000.

Target

  • Function

    Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by IGF-I, PDGF and neuropeptide head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH.
  • Sequence similarities

    Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV2 sub-subfamily.
    Contains 6 ANK repeats.
  • Post-translational
    modifications

    N-glycosylated.
    Phosphorylated by PKA.
  • Cellular localization

    Cell membrane. Cytoplasm. Melanosome. Translocates from the cytoplasm to the plasma membrane upon ligand stimulation (By similarity). Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC12549 antibody
    • Osm 9 like TRP channel 2 antibody
    • Osm-9-like TRP channel 2 antibody
    • OTRPC2 antibody
    • Sac2b antibody
    • Stretch activated channel 2B antibody
    • Transient receptor potential cation channel subfamily V member 2 antibody
    • TRPV2 antibody
    • TRPV2_HUMAN antibody
    • Vanilloid receptor like protein 1 antibody
    • Vanilloid receptor-like protein 1 antibody
    • VRL 1 antibody
    • VRL antibody
    • VRL-1 antibody
    • VRL1 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for TRPV2 using ab236955 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for TRPV2 (green) using ab236955 at 1/266 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated goat anti-rabbit IgG (H+L). Counterstained with DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with primary antibody overnight at 4°C.

References

ab236955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up