Anti-TRPV3 antibody (ab231150)
Key features and details
- Rabbit polyclonal to TRPV3
- Suitable for: IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-TRPV3 antibody
See all TRPV3 primary antibodies -
Description
Rabbit polyclonal to TRPV3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human TRPV3 aa 671-790. Expressed in E. coli.
Sequence:NMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRN NSKTTLNAFEEVEEFPETSV
Database link: Q8NET8-1 -
Positive control
- WB: Recombinant human TRPV3 protein; Rat cerebrum lysate. IHC-P: Human breast cancer tissue; Kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab231150 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 91 kDa. |
Target
-
Function
Putative receptor-activated non-selective calcium permeant cation channel. It is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. Activation exhibits an outward rectification. May associate with TRPV1 and may modulate its activity. -
Tissue specificity
Abundantly expressed in CNS. Widely expressed at low levels. Detected in dorsal root ganglion (at protein level). -
Sequence similarities
Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV3 sub-subfamily.
Contains 3 ANK repeats. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 162514 Human
- Entrez Gene: 497948 Rat
- Omim: 607066 Human
- SwissProt: Q8NET8 Human
- Unigene: 446255 Human
- Unigene: 163151 Rat
-
Alternative names
- 1110036I10Rik antibody
- MGC124324 antibody
- MGC124325 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TRPV3 antibody (ab231150)
Formalin-fixed, paraffin-embedded human breast cancer tissue stained for TRPV3 with ab231150 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TRPV3 antibody (ab231150)
Formalin-fixed, paraffin-embedded human kidney tissue stained for TRPV3 with ab231150 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-TRPV3 antibody (ab231150) at 2 µg/ml + Rat cerebrum lysate
Predicted band size: 91 kDa -
Anti-TRPV3 antibody (ab231150) at 2 µg/ml + Recombinant human TRPV3 protein
Predicted band size: 91 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231150 has not yet been referenced specifically in any publications.