Overview

  • Product name

    Anti-TRPV6 antibody
  • Description

    Rabbit polyclonal to TRPV6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRPV6 aa 620-764.
    Sequence:

    DTHWRVAHERDELWRAQIVATTVMLERKLPRCLWPRSGICGREYGLGDRW FLRVEDRQDLNRQRIQRYAQAFHTRGSEDLDKDSVEKLELGCPFSPHLSL PMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQ


    Database link: Q9H1D0

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.

Target

  • Function

    Calcium selective cation channel probably involved in Ca(2+) uptake in various tissues, including Ca(2+) reabsorption in intestine. The channel is activated by low internal calcium level, probably including intracellular calcium store depletion, and the current exhibits an inward rectification. Inactivation includes both, a rapid Ca(2+)-dependent and a slower Ca(2+)-calmodulin-dependent mechanism, the latter may be regulated by phosphorylation. In vitro, is slowly inhibited by Mg(2+) in a voltage-independent manner. Heteromeric assembly with TRPV5 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating.
  • Tissue specificity

    Expressed at high levels in the gastrointestinal tract, including esophagus, stomach, duodenum, jejunum, ileum and colon, and in pancreas, placenta, prostate and salivary gland. Expressed at moderate levels in liver, kidney and testis. Expressed in locally advanced prostate cancer, metastatic and androgen-insensitive prostatic lesions but not detected in healthy prostate tissue and benign prostatic hyperplasia.
  • Sequence similarities

    Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV6 sub-subfamily.
    Contains 5 ANK repeats.
  • Post-translational
    modifications

    Glycosylated.
    Phosphorylation by PRKCA at the calmodulin binding site delays channel inactivation.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABP/ZF antibody
    • ABPZF antibody
    • Alu binding protein with zinc finger domain antibody
    • Calcium channel CaT1 antibody
    • Calcium transport protein 1 antibody
    • CaT L antibody
    • CaT Like antibody
    • CaT-L antibody
    • CaT-like antibody
    • CaT1 antibody
    • ecac antibody
    • ECaC2 antibody
    • Epithelial apical membrane calcium transporter/channel CaT1 antibody
    • Epithelial calcium channel 2 antibody
    • Epithelial calcium channel antibody
    • HSA277909 antibody
    • LP6728 antibody
    • MGC162545 antibody
    • NUDC antibody
    • Transient receptor potential cation channel subfamily V member 6 antibody
    • TrpV6 antibody
    • TRPV6_HUMAN antibody
    • ZFAB antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for TRPV6 using ab238107 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab238107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up