Overview

  • Product name

  • Description

    Rabbit polyclonal to TRRAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TRRAP aa 2628-2713.
    Sequence:

    TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVE AMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ


    Database link: Q9Y4A5

  • Positive control

    • A431 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab220478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    TRRAP (TRansformation/tRanscription domain Associated Protein) is an adapter protein that is found in a number of multiprotein chromatin complexes with histone acetyltransferase (HAT) activity. These complexes include PCAF, TFTC-HAT, TIP60 HAT, STAGA, and BAF53 complexes. TRRAP is thought to be responsible for the concerted and context-dependent recruitment of these complexes to chromatin during transcription, replication and DNA repair. TRRAP plays a key role in transcriptional activation by c-Myc, p53/TP53, E2F1 and E2F4.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 350/400 kDa PCAF associated factor antibody
    • PAF 350/400 antibody
    • PAF 400 antibody
    • PAF350/400 antibody
    • PAF400 antibody
    • STAF 40 antibody
    • STAF40 antibody
    • TR AP antibody
    • Tra 1 antibody
    • Tra1 antibody
    • Tra1 homolog antibody
    • Transactivation / transformation domain associated protein antibody
    • Transactivation/transformation domain associated protein antibody
    • Transformation/transcription domain associated protein antibody
    • TRAP antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling TRRAP with ab220478 at 4 μg/ml (green).

References

ab220478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up